Skip to content
AS FEATURED IN Daily Mail · Independent · Metro · The Sun · Mirror · Express · Netmums · OK! · Newsweek
AS FEATURED IN Daily Mail · Independent · Metro · The Sun · Mirror · Express · Netmums · OK! · Newsweek
AS FEATURED IN Daily Mail · Independent · Metro · The Sun · Mirror · Express · Netmums · OK! · Newsweek
AS FEATURED IN Daily Mail · Independent · Metro · The Sun · Mirror · Express · Netmums · OK! · Newsweek
AS FEATURED IN Daily Mail · Independent · Metro · The Sun · Mirror · Express · Netmums · OK! · Newsweek
AS FEATURED IN Daily Mail · Independent · Metro · The Sun · Mirror · Express · Netmums · OK! · Newsweek

IGF-1 LR3 Peptide UK: Long R3 IGF-I Evidence in the Peptides UK Market

  • by My Store Admin
Research Peptides UK

IGF-1 LR3 Peptide UK: Long R3 IGF-I Evidence in the Peptides UK Market

IGF-1 LR3, usually written Long R3 IGF-I in scientific literature, is an engineered 83-amino-acid analogue of human insulin-like growth factor 1. It combines the complete mature IGF-1 sequence with a 13-residue N-terminal extension and replacement of glutamic acid by arginine at position three of the IGF-1 domain. These changes markedly reduce binding to insulin-like growth factor-binding proteins while retaining activity at the type 1 IGF receptor. The molecule was developed principally as a potent mammalian-cell-culture supplement rather than as an authorised human medicine.

Author: It’s Me & You Clinic Editorial Team Published: 22 July 2026 Last reviewed: 22 July 2026 Reading time: Approximately 25 minutes Regulatory position checked: 22 July 2026
Research and medical notice: This article discusses IGF-1 LR3 identity, receptor biology, binding proteins, laboratory uses, animal research, human-evidence gaps, safety, analytical testing, anti-doping rules and UK regulation. It does not provide preparation, reconstitution, injection, dosing, timing, cycling, site-specific administration, bodybuilding, performance-enhancement, purchasing or self-experimentation instructions. It’s Me & You Clinic does not supply, prescribe, recommend or administer IGF-1 LR3.
Important distinction: IGF-1 LR3 is not the same substance as mecasermin. Mecasermin is recombinant human IGF-1 and has a narrowly defined authorised medical use in severe primary IGF-1 deficiency. No UK marketing authorisation for Long R3 IGF-I was identified in the official sources reviewed. The 2026 World Anti-Doping Agency Prohibited List bans IGF-1, mecasermin and IGF-1 analogues at all times.

Direct Answer

IGF-1 LR3 is a recombinant analogue of human insulin-like growth factor 1 containing 83 amino-acid residues. It has a 13-amino-acid extension at its N-terminus and an arginine in place of the glutamic acid normally found at position three of mature human IGF-1.

The modifications weaken its interaction with IGF-binding proteins. This can leave a larger proportion of the molecule available to activate IGF-1 receptors in cell-culture systems and selected animal models.

The name “Long” describes the additional N-terminal sequence. It should not be interpreted automatically as meaning that the molecule has a longer circulating half-life than native IGF-1. Animal research has reported that reduced binding-protein affinity can increase clearance while producing stronger tissue or glucose-lowering effects.

Long R3 IGF-I was engineered primarily to support mammalian cells during biopharmaceutical manufacturing. It is widely used as a research growth factor in serum-free cell-culture media.

No published clinical programme establishing the safety or effectiveness of standalone IGF-1 LR3 in humans was identified in the sources reviewed. Bodybuilding, local-muscle-growth, injury-repair, fat-loss, anti-ageing and performance claims rely on laboratory, animal or anecdotal information rather than controlled human trials.

IGF-1 LR3 Peptide Key Points

The main scientific and regulatory facts for readers researching IGF-1 LR3 within the Peptides UK market.

Scientific name Long R3 IGF-I
Peptide length Eighty-three amino acids
Main modification Glu3 replaced by Arg
Additional structure Thirteen-residue N-terminal extension
Primary receptor Type 1 IGF receptor
IGFBP affinity Substantially reduced
Original application Mammalian cell culture
Human approval None identified

What Is IGF-1 LR3 Peptide?

Long R3 IGF-I is a laboratory-engineered growth-factor analogue rather than a naturally occurring human hormone.

Native mature human IGF-1 is a single-chain protein containing 70 amino-acid residues and three intramolecular disulphide bridges.

IGF-1 LR3 contains all 70 residues of the mature IGF-1 domain, subject to one substitution, together with a 13-residue extension placed before the natural N-terminus.

The native glutamic acid at position three of human IGF-1 is replaced with arginine. The notation R3 refers to this arginine substitution.

The resulting molecule is commonly described as Long Arg3 IGF-I, Long R3 IGF-I, LR3 IGF-I or IGF-1 LR3.

At approximately 9.1 kilodaltons, it is larger and structurally more complex than many short peptides sold through research catalogues. It may also be described more accurately as a small recombinant protein.

Plain-English explanation: scientists took the natural 70-amino-acid IGF-1 protein, attached 13 additional amino acids to its beginning and changed its third natural amino acid. The result was designed to remain biologically active while avoiding much of the normal control exerted by IGF-binding proteins.

IGF-1 LR3 Names and Terminology

Similar-looking names can refer to structurally different growth factors.

Name Basic Meaning Important Distinction
Long R3 IGF-I Scientific name used frequently in research papers Contains both the N-terminal extension and Glu3-to-Arg substitution
IGF-1 LR3 Commercially common rearrangement of the name Usually intended to refer to Long R3 IGF-I
R3 IGF-I Seventy-residue IGF-1 with only the Glu3-to-Arg substitution Does not contain the 13-residue extension
Long IGF-I IGF-1 with the extension but without the R3 substitution Different binding and potency profile
Native IGF-1 Natural 70-residue mature human growth factor Binds strongly to IGF-binding proteins
Mecasermin Recombinant human IGF-1 medicine Authorised for a restricted medical indication and not an LR3 analogue
Des(1–3) IGF-I IGF-1 lacking its first three residues Another low-IGFBP-affinity analogue with a different sequence

A label stating only “IGF-1” is insufficient

An analytical document should distinguish native IGF-1, mecasermin, R3 IGF-I, Long IGF-I, Long R3 IGF-I and Des(1–3) IGF-I. They are not interchangeable substances.

IGF-1 LR3 Research in the Peptides UK Market

Commercial promotion commonly repurposes cell-culture and animal findings as personal-use claims.

IGF-1 LR3 appears in Peptides UK catalogues as a recombinant research protein, lyophilised vial or component within products marketed around muscle growth and recovery.

Typical promotional claims include increased muscle size, localised growth, improved protein synthesis, faster injury repair, enhanced nutrient uptake, fat reduction, increased strength and improved workout recovery.

These descriptions often omit that Long R3 IGF-I was engineered principally for use in mammalian cell culture, where its reduced binding-protein affinity makes it an efficient growth and survival supplement.

Research showing proliferation of cultured cells is not clinical evidence that the molecule builds safe, functional or proportionate skeletal muscle in a person.

Animal experiments demonstrate that the molecule can affect glucose, organ growth, endogenous hormone concentrations and multiple tissues. These are reasons for caution rather than proof of controlled muscle selectivity.

“Research grade” does not mean suitable for personal research

In legitimate scientific use, research-grade Long R3 IGF-I is handled within controlled laboratories and added to validated cell-culture systems. The term does not establish suitability for administration to a person.

What Does Native IGF-1 Do?

Understanding normal IGF-1 biology helps explain why bypassing its regulatory system may carry broad effects.

IGF-1 is produced in the liver and many other tissues. Growth hormone is an important regulator of hepatic IGF-1 production, although nutrition, insulin, age, sex hormones and local tissue signals also influence the system.

IGF-1 supports normal childhood growth and contributes to cell survival, differentiation, protein metabolism and tissue maintenance.

Most circulating IGF-1 is not freely available to receptors. It is carried by a family of IGF-binding proteins, particularly IGFBP-3 within a larger complex containing the acid-labile subunit.

Binding proteins extend the circulating persistence of native IGF-1, influence its delivery to tissues and limit immediate receptor exposure.

The body therefore regulates IGF-1 through production, binding proteins, receptor density, receptor signalling and feedback effects on growth hormone.

IGF-1 is not simply a muscle-growth switch

IGF-1 receptors are found in numerous tissues. Signalling can influence skeletal muscle, bone, cartilage, nerves, the cardiovascular system, internal organs and cells capable of abnormal proliferation.

IGF-1 LR3 Molecular and Scientific Profile

Correct identification requires confirmation of its extension, substitution, complete sequence and three native disulphide bonds.

Molecular identity

Long R3 IGF-I

An 83-residue, normally non-glycosylated recombinant polypeptide containing a modified human IGF-1 domain.

Its approximate molecular mass is 9.1 kilodaltons.

Experimental function

IGF-1 Receptor Agonist

The analogue retains activity at the type 1 IGF receptor while interacting much less strongly with several IGF-binding proteins.

Biological potency therefore depends heavily on the binding proteins present in the experimental system.

Preferred scientific name Long R3 insulin-like growth factor I
Common commercial name IGF-1 LR3
Length 83 amino-acid residues
Native IGF-1 domain 70 residues
N-terminal extension 13 residues
Primary substitution Glu3 to Arg within the IGF-1 domain
Approximate molecular mass Approximately 9.1 kDa
Disulphide bonds Three intramolecular bonds within the IGF-1 domain
Primary receptor Type 1 IGF receptor
IGF-binding-protein affinity Substantially lower than native IGF-1
Established human indication None identified

IGF-1 LR3 Amino-Acid Sequence

The molecule contains the extension followed by the modified mature human IGF-1 sequence.

The commonly described single-letter sequence is:

MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA

The first 13 residues, MFPAMPLSSLFVN, form the non-native N-terminal extension.

The following modified IGF-1 domain begins GPRT rather than the native GPET sequence because arginine replaces glutamic acid at position three.

Using native IGF-1 numbering, the correctly folded molecule contains disulphide bonds between Cys6 and Cys48, Cys18 and Cys61, and Cys47 and Cys52.

When numbered across the complete 83-residue LR3 sequence, these correspond to bonds between Cys19 and Cys61, Cys31 and Cys74, and Cys60 and Cys65.

The correct sequence does not prove the correct fold

IGF-1 can form alternative disulphide isomers. A product may contain all expected amino acids and still have incorrect cysteine pairing and substantially altered receptor activity.

What Do the “Long” and “R3” Modifications Change?

Both modifications were selected to alter production, folding and interaction with IGF-binding proteins.

The Thirteen-Residue Extension

The extension was derived from an N-terminal region used in recombinant fusion-protein production.

It helped improve production and folding of biologically active IGF analogues in bacterial expression systems.

The extension also contributes to reduced interaction with IGF-binding proteins.

The Glu3-to-Arg Substitution

Native human IGF-1 contains glutamic acid at position three. Long R3 IGF-I contains positively charged arginine at this position.

Research comparing several variants showed that the substitution strongly reduces IGFBP binding while maintaining meaningful IGF-1 receptor activity.

Combined Effect

Long R3 IGF-I is particularly potent in cell systems that release inhibitory IGF-binding proteins into the culture medium.

In cells that do not produce detectable binding proteins, LR3 can be no more potent or even less potent than native IGF-1.

Key interpretation: the analogue is not intrinsically more powerful in every setting. Much of its apparent potency comes from avoiding extracellular binding proteins that would otherwise restrict native IGF-1.

IGF-1 LR3 and IGF-Binding Proteins

Reduced binding-protein affinity is the defining biological feature of the molecule.

Six classical high-affinity IGF-binding proteins help regulate the distribution and activity of IGF-1 and IGF-2.

In circulation, IGFBP-3 is the predominant carrier and commonly participates in a ternary complex with IGF-1 and the acid-labile subunit.

Binding can protect native IGF-1 from rapid clearance while reducing immediate availability to cell-surface receptors.

Long R3 IGF-I has dramatically reduced affinity for IGFBPs. One embryo-culture study reported binding affinity at least three orders of magnitude lower than native IGF-1 under the tested conditions.

This can increase free receptor-accessible analogue in cell culture. It can also remove an important part of normal biological buffering.

Reduced binding does not mean that LR3 is incapable of interacting indirectly with the IGFBP system. Animal studies reported changes in endogenous IGF-1, IGF-2 and binding-protein concentrations following exposure.

Less binding is not automatically safer or better

Binding proteins are not merely obstacles. They help control transport, tissue delivery, clearance and receptor exposure. Bypassing them may increase activity but also reduce physiological regulation.

IGF-1 LR3, IGF-1 Receptors and Insulin Receptors

The analogue primarily targets IGF-1 receptors but can influence a connected receptor network.

Type 1 IGF Receptor

The IGF-1 receptor is a receptor tyrosine kinase structurally related to the insulin receptor.

Long R3 IGF-I retains substantial IGF-1 receptor affinity, although certain experiments report slightly lower receptor affinity than native IGF-1.

Insulin Receptor

IGF-1 can interact more weakly with insulin receptors, particularly at higher concentrations.

Cell-culture studies also describe activation of insulin receptors and hybrid receptors containing one IGF-1-receptor half and one insulin-receptor half.

Hybrid Receptors

IGF-1 and insulin receptor subunits can assemble into hybrid receptors in several tissues.

These hybrids complicate simple claims that LR3 affects only growth and has no insulin-like metabolic action.

Receptor selectivity is not absolute

The strong glucose-lowering effects reported in animals demonstrate that an IGF-1 analogue can produce clinically relevant insulin-like consequences even where its principal target is the IGF-1 receptor.

How Does IGF-1 LR3 Signal Inside Cells?

Receptor activation can stimulate both growth-related and survival-related pathways.

Binding to the IGF-1 receptor activates its intracellular tyrosine-kinase domains.

Receptor substrates then transmit signals into pathways including phosphoinositide 3-kinase, AKT and mechanistic target of rapamycin.

These pathways can influence glucose transport, protein synthesis, metabolism, cell survival and resistance to programmed cell death.

The receptor can also activate RAS, RAF, MEK and ERK signalling, which contributes to cell-cycle progression, proliferation and differentiation.

LR3 reaches an IGF-1 receptor
Receptor tyrosine kinase activates
PI3K-AKT and RAS-ERK pathways signal
Metabolism, survival and proliferation change
Tissue outcome depends on cell type and exposure

Protein synthesis is only one possible consequence

The same signalling network involved in muscle-cell biology also operates in internal organs, connective tissue and many tumour cells. It cannot be assumed to act only where a user intends.

Why Was Long R3 IGF-I Developed for Cell Culture?

Its established practical role is as a potent growth and survival supplement in mammalian-cell production systems.

Mammalian cells used to manufacture antibodies and recombinant proteins require nutrients and growth signals.

Serum supplies many of these factors but introduces variability, complex biological components and contamination risks.

Long R3 IGF-I was engineered to support proliferation and survival in serum-free or low-serum culture while reducing the amount of insulin or native IGF-1 required.

Research in Chinese hamster ovary cells and human embryonic kidney cells found that LR3 could support cell growth and survival at substantially lower concentrations than insulin.

The high potency was linked to activation of IGF-1 receptors, insulin receptors or hybrid receptors in the selected cell systems.

These results are valuable for biopharmaceutical manufacturing because cells remain viable and productive within a controlled vessel.

Cell-culture potency is not a human treatment claim

A molecule chosen because it keeps industrial production cells alive and proliferating should not be described automatically as safe for uncontrolled systemic exposure.

Does “Long R3” Mean Long Acting?

The word “Long” describes sequence length rather than a clinically established prolonged human half-life.

The analogue is called Long R3 because it contains the 13-residue extension.

Native IGF-1 persists in circulation partly because IGF-binding proteins protect it from rapid clearance.

LR3 interacts poorly with these proteins. Animal studies therefore found that it could be cleared from circulation faster than native IGF-1.

Despite faster clearance, its reduced sequestration can increase immediate tissue availability and produce potent biological effects.

In pigs and marmoset monkeys, low-binding-protein-affinity IGF variants produced stronger and more prolonged glucose-lowering effects than native IGF-1.

Correct interpretation: longer sequence, faster unbound distribution and stronger pharmacodynamic activity can coexist. No validated human half-life for standalone IGF-1 LR3 was identified.

IGF-1 LR3 Animal Research

Animal experiments confirm broad biological activity but do not establish a safe human enhancement treatment.

Guinea pigs

Organ and Tissue Growth

Continuous LR3 infusion stimulated growth of selected organs and altered circulating IGF-1, IGF-2 and binding-protein concentrations.

Organ growth is not equivalent to selective skeletal-muscle improvement.

Pigs and primates

Glucose Reduction

Low-IGFBP-affinity variants were two to three times more potent than native IGF-1 at lowering plasma glucose to its lowest point.

The finding highlights a potentially serious metabolic effect.

Rats

Anabolic Measurements

LR3 produced growth and body-composition changes at lower molar exposure than native IGF-1 in selected experiments.

The studies involved controlled research animals rather than athletes or patients.

Food restriction

Body Weight Versus Muscle

One rat study reported that LR3 reduced body-weight loss during food restriction but did not preserve skeletal muscle as expected.

This contradicts simplistic claims of guaranteed muscle protection.

Other models have examined intestinal growth, embryonic development, mammary signalling, protein metabolism and cardiac-cell proliferation.

Results differ according to species, age, nutritional state, tissue, exposure pattern and local binding-protein environment.

Animal growth is not necessarily desirable growth

Increased weight or organ size does not establish improved health, strength, athletic performance or long-term safety.

IGF-1 LR3 Muscle and Anabolic Research

Evidence involving cultured myoblasts and animals is routinely overstated as proof of human bodybuilding effects.

Myoblast Proliferation

IGF-1 signalling participates in muscle-cell proliferation, differentiation and survival.

Long R3 IGF-I has been used in cultured myogenic cells because its reduced IGFBP affinity can produce a strong receptor response.

A culture dish does not reproduce human muscle architecture, blood supply, connective tissue, endocrine feedback or whole-body glucose regulation.

Animal Protein Metabolism

Experiments in cattle, pigs and rodents have investigated nitrogen balance, protein synthesis, body composition and lean-tissue preservation.

Results have not shown a uniform selective increase in skeletal muscle. Some studies reported broader growth effects or limited preservation under catabolic conditions.

No Controlled Human Hypertrophy Trial

No randomised human trial was identified showing that standalone IGF-1 LR3 increases muscle mass, strength or sporting performance safely.

No validated exposure-response relationship, clinical monitoring protocol or long-term risk profile exists for this proposed use.

More signalling does not guarantee better-quality muscle

Muscle function depends on neural control, tendon adaptation, blood supply, training, recovery and tissue architecture. Increasing growth-factor signalling cannot be assumed to improve all of these systems proportionately.

Can IGF-1 LR3 Produce Site-Specific Muscle Growth?

No controlled human evidence establishes reliable localised hypertrophy from administration near a selected muscle.

Online discussions sometimes claim that LR3 acts only near the place where it is introduced.

Peptides can enter local blood vessels and lymphatic pathways, after which systemic distribution may occur.

IGF-1 receptors are present throughout the body, and reduced binding-protein affinity may increase unbound distribution rather than confining the molecule.

Local tissue exposure also cannot guarantee selective action on mature muscle fibres. Fibroblasts, blood vessels, nerves, connective tissue and other nearby cells may express relevant receptors.

No published controlled human study was identified comparing targeted muscle growth with systemic exposure or non-target tissue effects.

The injection location is not a biological targeting system

True tissue targeting generally requires validated delivery technology, receptor selectivity and pharmacokinetic evidence. Physical proximity alone does not provide that assurance.

IGF-1 LR3 Injury, Repair and Recovery Claims

Growth-factor biology provides a plausible research hypothesis but not an established injury treatment.

IGF-1 signalling contributes to cell survival, matrix production and regeneration in several experimental tissues.

This has encouraged research involving muscle injury, bone, cartilage, nerves and intestinal tissue.

Healing requires inflammation, removal of damaged material, vascular supply, mechanical loading, collagen organisation and remodelling.

Excessive or poorly timed growth signalling could produce disorganised tissue, fibrosis or growth of cells that should not be stimulated.

No authorised human indication exists for tendon injury, ligament injury, muscle tears, fractures, neuropathy or postoperative recovery.

Evidence involving native IGF-1, local gene expression or animal models cannot be attributed automatically to externally supplied Long R3 IGF-I.

What Human Evidence Exists for IGF-1 LR3?

Direct human clinical evidence for the standalone analogue is absent or extremely limited.

No Authorised Clinical Development Programme Identified

No marketing authorisation for Long R3 IGF-I was identified through the MHRA or EMA sources reviewed.

No completed conventional clinical programme establishing human pharmacokinetics, therapeutic effectiveness, safe exposure ranges or long-term adverse effects was identified.

IGF-Linked Drug Conjugates

Experimental oncology programmes have investigated drug conjugates containing modified IGF-1-like targeting proteins.

These conjugates are chemically different medicines in which a cytotoxic drug is attached to a modified growth factor.

Their human exposure does not establish the safety of unconjugated Long R3 IGF-I or its use for muscle enhancement.

Black-Market and Anti-Doping Evidence

Anti-doping researchers describe Long R3 IGF-I as an unapproved analogue available through black-market bodybuilding channels.

Detection studies focus on identifying misuse and metabolites rather than demonstrating safety or benefit.

Anecdotes are not a substitute for human trials

User reports cannot establish product identity, exposure, causality, adverse-event frequency or what would have happened without the substance.

IGF-1 LR3 Compared With Mecasermin

The presence of an authorised IGF-1 medicine does not validate the LR3 analogue.

Feature IGF-1 LR3 Mecasermin
Basic identity Modified 83-residue IGF-1 analogue Recombinant human IGF-1
Sequence N-terminal extension plus Glu3-to-Arg substitution Matches mature human IGF-1
IGFBP affinity Markedly reduced Native-like binding
Primary established use Mammalian cell culture Severe primary IGF-1 deficiency in eligible children and adolescents
Human clinical programme No adequate programme identified Regulatory clinical and long-term safety monitoring
Product quality Depends on the research manufacturer Authorised pharmaceutical specification
UK status No marketing authorisation identified Prescription medicine

Increlex contains mecasermin and is authorised for the long-term treatment of growth failure associated with confirmed severe primary IGF-1 deficiency.

Its use requires specialist diagnosis, medical monitoring and management of risks including hypoglycaemia.

Product information also includes warnings concerning intracranial hypertension, tonsillar enlargement, scoliosis progression, slipped capital femoral epiphysis, cardiomegaly and benign or malignant neoplasia.

These adverse effects cannot be assigned directly to LR3 without human evidence. They demonstrate, however, that clinically manipulating IGF-1 signalling is not a minor or risk-free intervention.

Mecasermin evidence cannot be transferred to LR3

The molecules differ in sequence, IGFBP interaction, pharmacology and regulatory manufacturing. An authorised indication for mecasermin is not an implied authorisation for IGF-1 LR3.

IGF-1 LR3 Evidence at a Glance

The evidence supports laboratory utility and strong biological activity, not routine human use.

Research Question Evidence Type Current Finding Main Limitation
Is LR3 a defined IGF-1 analogue? Recombinant-protein and structural research Yes Commercial products still require batch-specific confirmation
Does it contain 83 amino acids? Sequence and protein-characterisation evidence Yes Some sellers confuse LR3 with 70-residue R3 IGF-I
Does it bind weakly to IGFBPs? Competition and ligand-binding assays Yes, substantially more weakly than native IGF-1 Affinity differs between IGFBPs and assay systems
Does it activate IGF-1 receptors? Cell-based receptor studies Yes Receptor activation does not establish human benefit
Is it useful in cell culture? CHO and HEK293 production studies Yes Industrial cell culture is not a human treatment model
Does “Long” mean a longer human half-life? Animal pharmacology Not established Reduced IGFBP binding can increase clearance
Can it lower blood glucose? Pig and marmoset studies Potent glucose lowering reported No safe human exposure profile
Can it stimulate tissue growth? Cell and animal studies Yes, in selected tissues and models Growth is not muscle selective or necessarily beneficial
Does it increase human muscle mass? Controlled clinical evidence Not established No adequate human hypertrophy trial identified
Does it increase human strength? Controlled clinical evidence Not established No trial with validated strength outcomes identified
Does it cause localised muscle growth? Human clinical evidence Not established No validated tissue-targeting evidence
Does it repair injuries? Mostly mechanistic and preclinical research Not established clinically No authorised injury indication
Is long-term human safety known? Clinical evidence No No adequate safety programme identified
Is it approved in the UK? Official product-source review No marketing authorisation identified Online availability is not approval
Is it prohibited in sport? WADA 2026 Prohibited List Yes, as an IGF-1 analogue Prohibition applies at all times

Important IGF-1 LR3 Research Limitations

Commercial summaries frequently remove the experimental context needed to understand the findings.

  • The molecule was developed principally for mammalian cell culture.
  • Many studies investigate cells rather than living organisms.
  • Cell lines may express abnormal receptor concentrations.
  • Cell-culture media lack normal endocrine feedback.
  • Cell-culture potency depends strongly on the presence of IGFBPs.
  • Animal species differ in IGF-binding proteins and receptor biology.
  • Several animal experiments used continuous infusion.
  • Continuous infusion does not model every proposed commercial use.
  • Animal organ growth is not evidence of beneficial human growth.
  • Animal glucose effects suggest risk rather than treatment benefit.
  • No validated human pharmacokinetic profile was identified.
  • No established human half-life was identified.
  • No controlled human muscle-growth trial was identified.
  • No controlled human strength trial was identified.
  • No localised-hypertrophy trial was identified.
  • No human injury-repair indication was established.
  • No long-term cardiovascular safety programme was identified.
  • No long-term cancer-safety programme was identified.
  • No reproductive or developmental safety programme was identified.
  • No paediatric LR3 safety programme was identified.
  • No validated interaction studies with insulin or diabetes medicines were identified.
  • No reliable adverse-event incidence can be calculated.
  • Research-market products may not contain LR3.
  • Products may contain native IGF-1 or R3 IGF-I instead.
  • Incorrect disulphide folding can reduce or alter activity.
  • HPLC alone may not distinguish every folding isomer.
  • Bacterial expression can introduce host-cell impurities and endotoxin.
  • Storage conditions can cause oxidation, aggregation or degradation.
  • Black-market anecdotes lack verified product identity.

IGF-1 LR3 and Hypoglycaemia

Potent glucose lowering is one of the clearest safety concerns supported by animal evidence.

IGF-1 signalling can increase glucose uptake and suppress hepatic glucose production.

Its receptor network overlaps with insulin signalling, and some cells contain IGF-1 and insulin hybrid receptors.

In pigs and marmoset monkeys, IGF-1 variants with poor binding-protein affinity produced glucose-lowering effects two to three times more potent than native IGF-1.

Severe hypoglycaemia can cause sweating, shaking, confusion, behavioural change, loss of coordination, seizures, loss of consciousness, brain injury or death.

The authorised IGF-1 medicine mecasermin must be managed carefully around food intake because of its insulin-like hypoglycaemic effects.

There is no validated human LR3 protocol defining how product variability, nutrition, exercise, kidney function, liver function or other medicines alter this risk.

Absence of human case reports does not establish safety

An unauthorised substance lacks organised prescribing records and systematic pharmacovigilance. Serious reactions may be misattributed, unreported or never linked to the product.

Uncontrolled Tissue and Organ Growth Concerns

The receptor is distributed widely, making selective skeletal-muscle action biologically unlikely.

IGF-1 receptor activation can promote proliferation and survival in responsive tissues.

Animal studies involving LR3 have reported changes in organ weight, intestinal growth and cardiac-cell behaviour.

Potential concerns arising from excessive IGF signalling include enlargement of soft tissue, internal organs, tonsillar or lymphoid tissue and cardiac structures.

In growing individuals, IGF signalling can influence bones and growth plates. In adults, closed growth plates do not make all bone and connective-tissue effects impossible.

Clinical mecasermin information includes monitoring for scoliosis progression, slipped capital femoral epiphysis, tonsillar hypertrophy and cardiomegaly.

These are not proven LR3 outcomes, but no evidence shows that the modified analogue avoids them.

IGF-1 LR3, Cancer Biology and Neoplasia

The evidence does not show that LR3 causes cancer in humans, but its mechanism creates a serious unresolved concern.

IGF-1 receptor signalling promotes proliferation and resistance to programmed cell death in many experimental systems.

Numerous tumour cell lines express IGF-1 receptors and respond to IGF-1 or low-binding-protein-affinity analogues.

Reduced IGFBP affinity can weaken one extracellular mechanism that normally limits receptor access.

This does not mean that every exposure initiates cancer. Cancer development requires accumulated genetic and environmental changes.

A growth factor could nevertheless support survival or expansion of an existing abnormal cell population.

Mecasermin is contraindicated where active or suspected neoplasia is present. Post-marketing reports include benign and malignant neoplasms, with concern greater during unapproved use or exposure above recommended limits.

No adequate long-term human carcinogenicity or tumour-progression evidence exists for IGF-1 LR3.

“No proof that it causes cancer” is not proof of safety

The responsible conclusion is that human cancer risk remains unknown and biologically important, particularly where the substance is designed to reduce normal IGF-binding-protein control.

Other IGF-1 LR3 Safety Uncertainties

No reliable human adverse-effect profile exists for the standalone analogue.

Neurological and Intracranial Effects

Authorised recombinant IGF-1 treatment has been associated with headache and intracranial hypertension.

No evidence establishes whether LR3 creates a lower, similar or higher risk.

Fluid and Cardiovascular Effects

Changes in tissue growth, sodium handling and vascular signalling could influence swelling, blood pressure or cardiac function.

Long-term cardiovascular monitoring data for LR3 are absent.

Endocrine Feedback

Animal studies show that external IGF analogues can suppress growth hormone and alter endogenous IGF and binding-protein concentrations.

The recovery and clinical importance of these changes in humans are unknown.

Immune Reactions

Recombinant proteins can provoke immune responses, particularly where aggregates, incorrectly folded proteins or host-cell impurities are present.

No adequate human immunogenicity assessment was identified for research-market LR3.

Product-Quality Risks

  • Incorrect active protein
  • Native IGF-1 substituted for LR3
  • R3 IGF-I substituted for Long R3 IGF-I
  • Incorrect or missing N-terminal extension
  • Failure to confirm the Glu3-to-Arg substitution
  • Incorrect disulphide pairing
  • Reduced cysteine residues
  • Misfolded IGF-1 isomers
  • Protein aggregates
  • Oxidised methionine or other residues
  • Truncated N-terminal products
  • Host-cell proteins
  • Residual bacterial DNA
  • Bacterial endotoxin
  • Residual purification reagents
  • Incorrect net protein quantity
  • Unverified sterile quality
  • Degradation during transport
  • Certificates unrelated to the supplied batch

How IGF-1 LR3 Research Material Should Be Analytically Tested

An 83-residue disulphide-rich protein requires substantially more analysis than a single HPLC purity result.

Intact identity

High-Resolution Mass Spectrometry

The observed intact mass should support the complete 83-residue LR3 protein and expected oxidation state.

Sequence

Peptide Mapping and Tandem MS

Digestion and fragment analysis should confirm the extension, IGF-1 domain and Glu3-to-Arg substitution.

Folding

Disulphide-Bond Mapping

Testing should verify the three native IGF-1-domain disulphide linkages and exclude scrambled isomers.

Free cysteine

Reduced-Thiol Assessment

Unexpected free thiols can indicate incomplete folding, reduction or instability.

Quantity

Net Protein Assay

Active protein content should be quantified independently of water, buffer salts and total powder weight.

Biological activity

IGF-1 Receptor Potency

A validated cell-based assay should assess receptor phosphorylation or another relevant functional response.

Aggregates

Size-Exclusion Analysis

Orthogonal testing should assess dimers, oligomers and other higher-molecular-weight species.

Process impurities

Host-Cell and Endotoxin Testing

Recombinant bacterial material requires controls for host-cell proteins, residual DNA and endotoxin.

What a Meaningful IGF-1 LR3 Certificate Should Include

  • Complete Long R3 IGF-I name
  • Declared 83-residue length
  • Full amino-acid sequence
  • Confirmation of the 13-residue N-terminal extension
  • Confirmation of the Glu3-to-Arg substitution
  • Observed intact molecular mass
  • Peptide-map sequence coverage
  • Tandem-MS fragment evidence
  • Disulphide-bond map
  • Reduced-thiol result
  • Misfolded-isomer assessment
  • Net protein-content assay
  • Chromatographic purity
  • Aggregate result
  • N-terminal truncation results
  • Oxidation and deamidation profile
  • IGF-1 receptor potency
  • Declared expression system
  • Host-cell-protein result
  • Residual host-cell-DNA result
  • Bacterial-endotoxin result
  • Bioburden or sterility result where applicable
  • Water-content result
  • Batch-specific stability information
  • Testing-laboratory identity
  • Analytical methods and acceptance criteria
  • A statement identifying tests not performed

Why “99% HPLC” Is Not Enough

Reverse-phase HPLC may show that one major species dominates under a particular separation method.

It does not prove the correct 83-residue sequence, R3 substitution, disulphide arrangement, receptor potency or absence of aggregates.

Incorrectly folded IGF-1 can have markedly lower receptor and binding-protein activity while remaining chemically similar.

HPLC purity also does not establish endotoxin control, sterile quality or suitability for human administration.

Folding is part of identity

For disulphide-rich growth factors, the correct three-dimensional structure is essential. Sequence and molecular mass alone cannot establish a biologically authentic product.

IGF-1 LR3 Regulation in the Peptides UK Market

Regulatory information checked on 22 July 2026.

No UK Marketing Authorisation Identified

No current UK marketing authorisation for a medicinal product containing Long R3 IGF-I or IGF-1 LR3 was identified in the official product sources reviewed.

It should not be presented as an approved treatment for muscle loss, sports recovery, injury repair, growth-hormone deficiency, IGF-1 deficiency, neuropathy, ageing or another condition.

Mecasermin authorisation does not extend to modified IGF-1 analogues.

How the MHRA Assesses Product Status

MHRA guidance states that a product may be medicinal where it is presented as preventing or treating disease.

A product may also be medicinal where it is intended to restore, correct or modify physiological functions through pharmacological, immunological or metabolic action.

Claims involving muscle growth, protein synthesis, glucose metabolism, healing, hormone replacement or tissue regeneration could contribute to medicinal-product classification.

The MHRA considers explicit and implied claims, pharmacological properties, intended purpose, labels, websites, social media, instructions, images, testimonials and customer reviews.

“Research Use Only” Wording

A research disclaimer does not automatically determine the legal classification of a product.

Where the surrounding material promotes personal administration or physiological effects, the complete presentation may be assessed.

Advertising Restrictions

Regulation 279 of the Human Medicines Regulations restricts advertising a medicinal product unless the required authorisation, registration or certificate is in force.

This section provides general regulatory education rather than legal advice.

IGF-1 LR3 and Competitive Sport

Long R3 IGF-I falls within an expressly prohibited growth-factor category.

The 2026 World Anti-Doping Agency Prohibited List includes insulin-like growth factor 1, mecasermin and IGF-1 analogues in section S2.

The prohibition applies at all times, both in and out of competition.

Long R3 IGF-I is an IGF-1 analogue and is therefore prohibited even where a supplier describes it only as a research protein.

Anti-doping laboratories have developed mass-spectrometry methods capable of detecting Long R3 IGF-I and selected degradation products.

Athletes are responsible for prohibited substances found in their samples under strict-liability principles.

IGF-1 LR3 is prohibited in sport

A claim that the molecule is undetectable, not specifically named or intended only for recovery does not alter its prohibited status.

Common IGF-1 LR3 Peptide Claims Examined

Most promotional claims turn receptor biology or animal findings into unsupported human promises.

The claim

“IGF-1 LR3 is a natural human hormone.”

It contains a human IGF-1 domain.

The extension and R3 substitution make it an engineered analogue not normally produced by the human body.

The claim

“Long means it has a very long half-life.”

“Long” refers to the 13 additional residues.

Poor IGFBP binding can increase clearance, and no validated human half-life was identified.

The claim

“It is ten times stronger than IGF-1.”

LR3 can be substantially more potent in systems containing inhibitory IGFBPs.

Potency differs between assays, cells and tissues and cannot be represented by one universal multiplier.

The claim

“It builds human muscle.”

IGF signalling affects muscle-cell biology in laboratory and animal models.

No adequate controlled human hypertrophy trial was identified.

The claim

“It grows only the muscle where it is used.”

No validated targeting evidence supports this statement.

Systemic distribution and effects on multiple local cell types are possible.

The claim

“It creates new muscle fibres.”

IGF signalling can influence developmental myogenesis in experimental systems.

No human evidence establishes meaningful new-fibre formation following LR3 exposure.

The claim

“It preserves all muscle during dieting.”

Some animal research investigated catabolic states.

One food-restriction study found improved body-weight retention without preservation of skeletal muscle.

The claim

“It repairs tendons and injuries.”

IGF-1 participates in repair-related biology.

No authorised or clinically proven LR3 treatment exists for tendon, ligament or muscle injury.

The claim

“It cannot cause low blood sugar.”

IGF signalling has insulin-like metabolic effects.

LR3 and related low-IGFBP-affinity variants produced potent hypoglycaemic effects in animals.

The claim

“It cannot affect internal organs.”

IGF-1 receptors are widely distributed.

Animal studies have reported organ-growth and intestinal-growth effects.

The claim

“There is no cancer concern.”

No evidence proves that LR3 causes human cancer.

Its proliferative and anti-apoptotic signalling creates an unresolved concern for existing abnormal cells.

The claim

“It is medically approved because IGF-1 is prescribed.”

Mecasermin is an authorised recombinant human IGF-1 medicine.

IGF-1 LR3 is a different molecule with no identified UK marketing authorisation.

The claim

“It is not banned because LR3 is not named.”

WADA prohibits IGF-1 and its analogues.

Long R3 IGF-I falls within that category.

The claim

“A 99% HPLC result proves it is genuine.”

HPLC provides one measure of chromatographic composition.

It does not establish full sequence, disulphide folding, receptor potency, aggregates or endotoxin control.

IGF-1 LR3 Compared With Related Growth Factors

Closely related names can hide major differences in pharmacology and regulatory status.

Substance Basic Identity IGFBP Interaction Important Distinction
Long R3 IGF-I 83-residue extended E3R analogue Very low affinity Cell-culture growth factor with no authorised human use identified
Native IGF-1 Natural 70-residue growth factor High affinity Physiologically regulated through binding proteins
Mecasermin Recombinant human IGF-1 medicine Native-like affinity Authorised for severe primary IGF-1 deficiency
R3 IGF-I 70-residue E3R analogue Reduced affinity No 13-residue extension
Long IGF-I 83-residue extended analogue without E3R Reduced but distinct profile Not identical to Long R3 IGF-I
Des(1–3) IGF-I 67-residue truncated analogue Very low affinity Missing the first three native residues
IGF-2 Related endogenous growth factor Binds several IGFBPs Different receptor preferences and developmental role
Insulin Pancreatic peptide hormone Not regulated principally by IGFBPs Primarily activates insulin receptors
Mechano growth factor Term associated with an IGF-1 splice-variant-derived sequence Different and incompletely defined Not Long R3 IGF-I

How to Assess IGF-1 LR3 and Peptides UK Evidence Critically

Use this checklist before accepting a scientific, safety or product-quality statement.

  • Does the source call the molecule Long R3 IGF-I?
  • Is it distinguished from native IGF-1?
  • Is it distinguished from R3 IGF-I?
  • Is the 83-residue length stated?
  • Is the 13-residue extension identified?
  • Is the Glu3-to-Arg substitution confirmed?
  • Is the complete sequence provided?
  • Was intact mass confirmed?
  • Was peptide mapping performed?
  • Were all three disulphide bonds mapped?
  • Were misfolded isomers assessed?
  • Were aggregates measured?
  • Was receptor potency tested?
  • Was net protein content measured?
  • Was bacterial endotoxin tested?
  • Were host-cell proteins assessed?
  • Does the certificate match the supplied batch?
  • Was the study conducted in cells, animals or humans?
  • Did the cell system produce IGFBPs?
  • Was the exposure a continuous animal infusion?
  • Was muscle measured directly?
  • Was strength measured?
  • Were internal organs examined?
  • Were glucose measurements reported?
  • Was hypoglycaemia assessed?
  • Was cancer or abnormal-cell growth considered?
  • Was the finding independently replicated?
  • Is mecasermin evidence being attributed to LR3?
  • Is a cell-culture effect being described as human muscle growth?
  • Is the source selling the product it describes?

Medical and Editorial Review

This final article has been reviewed for medical context, evidence presentation, patient safety language and editorial clarity by the multidisciplinary panel below.

The reviewers and contributors are identified to provide clear authorship and accountability. Their inclusion does not represent endorsement of any research product, supplier, personal use, treatment claim or commercial statement discussed in this article.

Dr Laura Geige
Medical Director and Clinical Reviewer

Dr Laura Geige

Medical Director and Senior Aesthetics Practitioner at It’s Me & You Clinic, with a background in dentistry, medical aesthetics and cosmetic dermatology.

Dr Rimas Geiga
Medical and Nutritional Sciences Reviewer

Dr Rimas Geiga

Medical doctor with a special interest in nutritional sciences, dietology, metabolic health and evidence based preventative care.

Dr Snieguole Geige
Medical and Healthcare Reviewer

Dr Snieguole Geige

Dentist and medical doctor with experience across healthcare, preventative medicine and patient centred clinical standards.

Dr Giedre Narkiene
Dermatology Reviewer

Dr Giedre Narkiene

Medical doctor and board certified dermatologist with expertise in medical and cosmetic dermatology, skin health and patient safety.

Dr Veronika Matutyte
Medical and Gerontology Reviewer

Dr Veronika Matutyte

Medical doctor with training and professional experience in gerontology and healthcare management across clinical and hospital settings.

Livija Samušienė
Cosmetology and Skin Health Contributor

Livija Samušienė

Qualified cosmetologist with a Bachelor of Health Sciences in cosmetology and a professional interest in skin health, acne and evidence based aesthetic care.

IGF-1 LR3 Peptide UK Frequently Asked Questions

Evidence-led answers about Long R3 IGF-I structure, research, safety, sport and UK regulation.

What is IGF-1 LR3?

IGF-1 LR3 is an engineered 83-amino-acid analogue of human insulin-like growth factor 1.

What does LR3 mean?

“L” refers to the longer N-terminally extended sequence, while R3 refers to arginine replacing glutamic acid at position three of the IGF-1 domain.

How many amino acids does IGF-1 LR3 contain?

It contains 83 amino-acid residues: a 13-residue extension followed by a modified 70-residue IGF-1 domain.

Is IGF-1 LR3 naturally produced by the human body?

No. The human body produces native IGF-1, not the extended R3 analogue.

Is IGF-1 LR3 the same as IGF-1?

No. It contains an additional 13 residues and an amino-acid substitution that substantially reduce binding to IGF-binding proteins.

Is IGF-1 LR3 the same as mecasermin?

No. Mecasermin is recombinant human IGF-1. LR3 is a modified analogue with a different sequence and pharmacology.

Why was Long R3 IGF-I developed?

It was engineered primarily as a potent growth and survival supplement for mammalian cells used in biopharmaceutical production.

Why does LR3 bind poorly to IGF-binding proteins?

Its N-terminal extension and Glu3-to-Arg substitution alter regions involved in IGFBP interaction.

Does lower IGFBP binding make it stronger?

It can make LR3 more potent in systems where binding proteins would normally sequester native IGF-1. The effect is not identical in every cell or tissue.

Does “Long” mean it has a long half-life?

Not necessarily. “Long” refers to its additional sequence. Animal research suggests poor IGFBP binding can cause faster clearance despite potent biological effects.

What receptor does IGF-1 LR3 activate?

Its principal target is the type 1 IGF receptor. It may also influence insulin receptors and IGF-1/insulin hybrid receptors in some systems.

Does IGF-1 LR3 increase protein synthesis?

IGF-1-receptor signalling can activate protein-synthesis pathways in experimental cells and animals. No controlled human LR3 treatment effect has been established.

Does IGF-1 LR3 build muscle in humans?

No adequate controlled human trial was identified demonstrating safe increases in muscle size or strength.

Does it produce localised muscle growth?

No validated human evidence shows that LR3 remains confined to or selectively grows one chosen muscle.

Does IGF-1 LR3 help injuries heal?

IGF signalling participates in repair biology, but no authorised or clinically proven LR3 treatment exists for muscle, tendon, ligament or nerve injuries.

Does IGF-1 LR3 preserve muscle during dieting?

Human evidence is absent. One rat study found reduced body-weight loss during food restriction without preservation of skeletal muscle.

Can IGF-1 LR3 cause low blood sugar?

Potent glucose lowering has been reported in animal studies. The human risk is not quantified but is a major concern.

Can IGF-1 LR3 affect internal organs?

IGF-1 receptors occur in many tissues, and animal studies have reported organ and intestinal growth effects.

Does IGF-1 LR3 cause cancer?

No evidence establishes that it causes cancer in humans. Its proliferative and survival signalling creates an unresolved concern, particularly for existing abnormal cells.

Has IGF-1 LR3 been tested in humans?

No adequate published clinical programme for standalone LR3 administration was identified in the sources reviewed.

What is the human half-life of IGF-1 LR3?

No validated human pharmacokinetic half-life was identified.

Is IGF-1 LR3 approved in the UK?

No current UK marketing authorisation for Long R3 IGF-I was identified.

Does mecasermin approval make LR3 legal as a medicine?

No. Marketing authorisation applies to the exact authorised active substance, formulation, indication and manufacturer.

Does “Research Use Only” determine UK legal status?

No. The MHRA can consider intended use, pharmacological activity, claims, imagery, instructions and the complete commercial presentation.

Is IGF-1 LR3 prohibited by WADA?

Yes. IGF-1 and its analogues are prohibited at all times under the 2026 WADA Prohibited List.

Can anti-doping laboratories detect Long R3 IGF-I?

Published mass-spectrometry methods can detect Long R3 IGF-I and selected degradation products.

Why are disulphide bonds important?

They maintain the three-dimensional structure required for receptor activity. Incorrect cysteine pairing can produce a misfolded and biologically different protein.

Does 99% HPLC prove an LR3 product is authentic?

No. It does not prove full sequence, correct disulphide folding, receptor potency, aggregate control, endotoxin results or sterile quality.

What should an IGF-1 LR3 certificate include?

It should include the complete sequence, intact mass, R3 substitution, extension, peptide map, disulphide map, folding-isomer analysis, assay, aggregates, potency, host-cell impurities and endotoxin.

Does this article provide injection or bodybuilding instructions?

No. It does not provide preparation, reconstitution, injection, dosing, timing, cycling, site-specific administration or performance-enhancement guidance.

Key Takeaways

  • IGF-1 LR3 is more commonly called Long R3 IGF-I in scientific literature.
  • It is an engineered 83-residue analogue of human IGF-1.
  • It contains a 13-residue N-terminal extension.
  • Arginine replaces glutamic acid at position three of the IGF-1 domain.
  • These modifications substantially reduce IGF-binding-protein affinity.
  • Reduced IGFBP binding can increase receptor-accessible protein in experimental systems.
  • Its principal established use is as a mammalian-cell-culture supplement.
  • “Long” describes the extension rather than a proven prolonged human half-life.
  • Animal studies demonstrate potent glucose-lowering effects.
  • Animal studies also report broad organ and tissue-growth effects.
  • No adequate human muscle-growth or performance trial was identified.
  • No evidence establishes reliable site-specific muscle growth.
  • No human injury-repair indication has been established.
  • No reliable human pharmacokinetic or long-term safety profile exists.
  • Hypoglycaemia is a major biologically plausible risk.
  • Proliferative and anti-apoptotic signalling creates unresolved neoplasia concerns.
  • IGF-1 LR3 is not the authorised medicine mecasermin.
  • No UK marketing authorisation for LR3 was identified.
  • IGF-1 analogues are prohibited at all times by WADA.
  • Correct sequence, folding, potency, aggregate and endotoxin testing are essential.

Relevant It’s Me & You Clinic Peptides UK Resources

Explore related evidence-led articles and clinical contributor profiles.

HGH 191AA Peptide UK

Review the complete human growth-hormone protein and its relationship with endogenous IGF-1 production.

Browse related peptide guides

IGF-1 DES Peptide UK

Compare LR3 with a separate shortened IGF-1 analogue that also has reduced binding-protein affinity.

Browse related peptide guides

References

  1. Francis GL, Ross M, Ballard FJ, et al. Novel recombinant fusion protein analogues of insulin-like growth factor I indicate the relative importance of IGF-binding protein and receptor binding for enhanced biological potency. Journal of Molecular Endocrinology. 1992;8(3):213–223. PubMed record
  2. Hunt L, Hacker DL, Grosjean F, et al. LONG R3 IGF-I as a more potent alternative to insulin in serum-free culture of HEK293 cells. Molecular Biotechnology. 2007;34(2):201–208. PubMed record
  3. Flint DJ, Tonner E, Beattie J, Allan GJ. Several IGF-I analogues and IGF/IGFBP-3 complexes fail to mimic the effect of growth hormone upon lactation in the rat. Journal of Endocrinology. 1994. PubMed record
  4. Prelle K, Stojkovic M, Boxhammer K, et al. IGF-I and Long R3 IGF-I differently affect bovine embryo development and expression of IGF-binding proteins and IGF receptors. Endocrinology. 2001;142(3):1309–1316. PubMed record
  5. Tomas FM, Walton PE, Dunshea FR, Ballard FJ. IGF-I variants which bind poorly to IGF-binding proteins show more potent and prolonged hypoglycaemic action than native IGF-I in pigs and marmoset monkeys. Journal of Endocrinology. 1997;155(2):377–386. PubMed record
  6. Tomas FM, Knowles SE, Owens PC, et al. Superior potency of infused IGF-I analogues which bind poorly to IGF-binding proteins in rats. 1996. PubMed record
  7. Conlon MA, Tomas FM, Owens PC, et al. Long R3 IGF-I infusion stimulates organ growth but reduces circulating IGF-I, IGF-II and binding-protein concentrations in guinea pigs. Journal of Endocrinology. 1995;146(2):247–253. PubMed record
  8. Tomas FM, Knowles SE, Owens PC, et al. Anabolic effects of IGF-I and an IGF-I variant in normal female rats. Journal of Endocrinology. 1993. PubMed record
  9. Tomas FM, Knowles SE, Owens PC, Read LC, Ballard FJ. LR3 IGF-I ameliorates loss of body weight but not skeletal muscle during food restriction. 2001. PubMed record
  10. Milner SJ, Carver JA, Ballard FJ, Francis GL. Probing the disulphide-folding pathway of IGF-I and Long Arg3 IGF-I. Biotechnology and Bioengineering. 1999. PubMed record
  11. Yang Y, Wu J, Watson JT. Probing the folding pathways of Long R3 IGF-I and IGF-I through disulphide intermediates and mass spectrometry. Journal of Biological Chemistry. 1999;274(53):37598–37604. PubMed record
  12. Laajoki LG, Francis GL, Wallace JC, Carver JA, Keniry MA. Solution structure and backbone dynamics of Long Arg3 IGF-I. 2000. PubMed record
  13. Raschdorf F, Dahinden R, Maerki W, Richter W, Merryweather JP. Location of disulphide bonds in recombinant human insulin-like growth factors. Biomedical and Environmental Mass Spectrometry. 1988. PubMed record
  14. Mongongu C, Kuuranne T, Ericsson M, et al. Detection of Long R3 IGF-I, Des(1–3) IGF-I and R3 IGF-I using immunopurification and high-resolution mass spectrometry for anti-doping purposes. Drug Testing and Analysis. 2021. PubMed record
  15. World Anti-Doping Agency. 2026 Prohibited List. Section S2, peptide hormones, growth factors, related substances and mimetics. WADA 2026 Prohibited List
  16. European Medicines Agency. Increlex, mecasermin: European public assessment report. EMA Increlex page
  17. European Medicines Agency. Increlex product information and Summary of Product Characteristics. EMA product information
  18. Medicines and Healthcare products Regulatory Agency. MHRA Products database. Search UK authorised medicine information
  19. Medicines and Healthcare products Regulatory Agency. Borderline products: how to tell if your product is a medicine. Updated 2 July 2026. MHRA borderline-product guidance
  20. Human Medicines Regulations 2012, Regulation 279. UK medicinal-product advertising restriction
  21. International Council for Harmonisation. ICH Q2(R2): Validation of Analytical Procedures. ICH analytical guideline
  22. UK Accreditation Service. Laboratory accreditation and ISO/IEC 17025. UKAS laboratory guidance

Educational, Medical and Research Disclaimer

This article is provided solely for general scientific, analytical, medical and regulatory education. It does not constitute personalised medical advice, endocrinology treatment, diabetes treatment, bodybuilding advice, sports-performance advice, injury treatment, prescribing advice, pharmaceutical validation or legal advice.

It does not describe or endorse obtaining, preparing, reconstituting, dosing, injecting, targeting, cycling, combining or personally experimenting with IGF-1 LR3, Long R3 IGF-I, R3 IGF-I, native IGF-1 or mecasermin.

Findings from industrial cell culture, isolated cells, animal infusions and anti-doping studies should not be interpreted as proof that IGF-1 LR3 safely increases human muscle, strength, healing, athletic performance or longevity.

Authorised mecasermin evidence should not be transferred to Long R3 IGF-I. The substances differ in sequence, binding-protein affinity, pharmacology, manufacturing controls and regulatory status.

Products marked “Research Use Only” are not automatically authorised, legally compliant, correctly identified, correctly folded, endotoxin controlled, sterile, clinically suitable or safe for human use.

It’s Me & You Clinic does not supply, prescribe, recommend or administer IGF-1 LR3. Anyone concerned about growth, low IGF-1, hypoglycaemia, muscle loss, injury recovery or another medical issue should seek assessment from an appropriately qualified healthcare professional.

 


Previous     Next
Patient Experiences

Real Patient Transformations at It’s Me and You Clinic

Discover why clients across South West London and Surrey choose It’s Me and You Clinic for their facial aesthetics journey. Located in Siddeley House on Kingston Hall Road, our doctor-led clinic is celebrated for delivering stunning, natural-looking results that enhance your unique beauty rather than altering it. From popular anti-wrinkle injections to advanced dermal fillers, our premium treatments are highly recommended by patients and beauty influencers alike for our precise techniques and exceptional safety standards. Whether you are commuting via Kingston Train Station or parking at the nearby Bentalls Shopping Centre for a day of self-care, our welcoming team is dedicated to providing a transformative experience tailored completely to you.

Diren’s Microneedling Experience

Diren from pilateswithdiren recently visited our doctor led facility for a rejuvenating microneedling treatment and highly recommends her calm, professional experience. Located at Siddeley House near Kingston Train Station and the Bentalls Shopping Centre, our clinic specialises in bespoke skin health for clients across South West London and Surrey.

Mila’s Aesthetics Journey with It’s Me and You Clinic

We love the beautiful, natural looking results beauty blogger Mila from thedopaminediaries achieved at our Kingston upon Thames clinic. Based in Siddeley House near Kingston Train Station and the Bentalls Shopping Centre, our doctor led team delivers premium, tailored facial treatments for clients across South West London and Surrey.

Jessie’s Skin Booster Treatment

Jessie from jessie_foodies_london visited our clinic to experience the advanced Neauvia Hydro Deluxe skin booster treatment for a deep hydration lift. Our doctor led team at Siddeley House near Kingston Train Station and the Bentalls Shopping Centre specialises in these premium micro injections to boost collagen across South West London and Surrey. Jessie loved her quick session, gentle care, and the plumper, glowing results with minimal downtime.

Erika’s Cheek Filler Transformation

Erika from lolsbox1 visited Dr Laura Geige for a bespoke cheek filler treatment to address long standing structural insecurities and restore her facial confidence. Our doctor led team at Siddeley House near Kingston Train Station and the Bentalls Shopping Centre specialises in these advanced contouring procedures for clients across South West London and Surrey. She was absolutely thrilled with her glowing results, noting that the highly recommended treatment left her smiling and feeling incredibly confident.

JOIN OUR PRIVATE SKIN COMMUNITY

Gain exclusive early access to Dr Laura’s busy clinic days, premium anti ageing tips, and bespoke skin transformation insights.

Loose skin treatment at It’s Me and You Clinic in London, Kingston upon Thames and Surrey – skin tightening for face, neck, stomach and arms using HIFU, radiofrequency and non-surgical lifting to treat sagging and ageing skin.

Wait ! Before you go....

⭐ WIN FREE AESTHETIC TREATMENTS ⭐

Have you visited It's Me & You Skin Clinic?

Share your experience and you'll be entered into our exclusive prize draw for the chance to win complimentary aesthetic treatments, premium skincare products, and clinic vouchers.

✨ Thank you for supporting our doctor led skin clinic in Kingston Upon Thames. Your feedback helps future patients and allows us to continue providing exceptional care across Surrey and London.

Prize draw terms and conditions apply.