Skip to content
AS FEATURED IN Daily Mail · Independent · Metro · The Sun · Mirror · Express · Netmums · OK! · Newsweek
AS FEATURED IN Daily Mail · Independent · Metro · The Sun · Mirror · Express · Netmums · OK! · Newsweek
AS FEATURED IN Daily Mail · Independent · Metro · The Sun · Mirror · Express · Netmums · OK! · Newsweek
AS FEATURED IN Daily Mail · Independent · Metro · The Sun · Mirror · Express · Netmums · OK! · Newsweek
AS FEATURED IN Daily Mail · Independent · Metro · The Sun · Mirror · Express · Netmums · OK! · Newsweek
AS FEATURED IN Daily Mail · Independent · Metro · The Sun · Mirror · Express · Netmums · OK! · Newsweek

GLP-1 Peptide UK: Native Hormone and Medicines in the Peptides UK Market

  • by My Store Admin
Research Peptides UK

GLP-1 Peptide UK: Native Hormone and Medicines in the Peptides UK Market

Glucagon-like peptide-1, usually abbreviated to GLP-1, is a naturally produced peptide hormone released after food reaches the digestive system. Its active forms help coordinate glucose-dependent insulin secretion, glucagon regulation, gastric emptying and signals associated with appetite and satiety. Modern medicines including liraglutide, dulaglutide and semaglutide act at the GLP-1 receptor but are structurally modified to remain active much longer than native GLP-1. Tirzepatide activates both GIP and GLP-1 receptors and should not be described as native GLP-1 or a pure GLP-1 analogue.

Author: It’s Me & You Clinic Editorial Team Published: 22 July 2026 Last reviewed: 22 July 2026 Reading time: Approximately 26 minutes Regulatory position checked: 22 July 2026
Medical and research notice: This article explains native GLP-1 biology, GLP-1 receptor agonists, authorised medicines, human evidence, analytical testing, safety and UK regulation. It does not provide prescribing, dose-escalation, injection, reconstitution, switching, combination, weight-loss, diabetes-treatment, purchasing or self-experimentation instructions. It’s Me & You Clinic does not supply or administer unlicensed research-market GLP-1 products.
Important evidence distinction: Unlike many compounds discussed in research-peptide catalogues, several GLP-1 receptor agonists are authorised prescription medicines supported by large randomised clinical trials. Their evidence and authorisation apply to the exact active substance, formulation, indication and patient group. They do not validate a generic vial marked “GLP-1”, an imitation pen or another unauthorised peptide product.
Current UK safety update: In January 2026, the MHRA strengthened warnings for GLP-1 receptor agonists and dual GIP/GLP-1 receptor agonists following rare reports of severe acute pancreatitis, including necrotising and fatal cases. In February 2026, semaglutide product information was updated to include non-arteritic anterior ischaemic optic neuropathy, or NAION, as a very rare risk.

Direct Answer

GLP-1 is an endogenous peptide produced through tissue-specific processing of the proglucagon protein. The predominant active circulating form is GLP-1(7–36) amide, a 30-amino-acid peptide. A second active form, GLP-1(7–37), contains one additional glycine residue.

Native GLP-1 activates the GLP-1 receptor, a G-protein-coupled receptor. When glucose is elevated, it enhances insulin secretion. It can also suppress glucagon, delay gastric emptying and reduce food intake under appropriate physiological or experimental conditions.

The natural peptide is removed from active circulation rapidly. Dipeptidyl peptidase-4, known as DPP-4, removes its first two amino acids, producing GLP-1(9–36) amide. Native active GLP-1 has a plasma half-life measured in minutes rather than hours or days.

Semaglutide and liraglutide are modified GLP-1 analogues designed to resist rapid degradation and remain in circulation longer. Dulaglutide is a larger fusion construct. Exenatide is based on exendin-4 rather than the human GLP-1 sequence. Tirzepatide is a dual GIP and GLP-1 receptor agonist.

Authorised medicines have established roles in type 2 diabetes, weight management and, for particular products and populations, cardiovascular-risk reduction. Native GLP-1 peptide itself is not an authorised routine UK treatment, and research-market material is not equivalent to an approved medicine.

GLP-1 Peptide Key Points

The central distinctions needed to interpret GLP-1 research and commercial claims accurately.

Full name Glucagon-like peptide-1
Main active form GLP-1(7–36) amide
Peptide length Thirty amino acids
Protein precursor Proglucagon
Primary receptor GLP-1 receptor
Native half-life Approximately one to two minutes
Medicine class GLP-1 receptor agonists
Main market warning A generic GLP-1 vial is not Ozempic, Wegovy or Mounjaro

What Is GLP-1 Peptide?

GLP-1 is an incretin hormone produced after the proglucagon protein is processed in specialised cells.

The name glucagon-like peptide-1 reflects its origin within the same precursor protein that contains glucagon. It does not mean that GLP-1 has the same physiological action as glucagon.

Nutrients entering the intestine stimulate endocrine L cells to release active GLP-1. Neural and hormonal signals can contribute to the timing of this response.

Blood concentrations rise after meals. Active GLP-1 then acts through the GLP-1 receptor in several tissues involved in glucose regulation, digestion and energy intake.

GLP-1 is described as an incretin because it contributes to the greater insulin response produced by oral glucose compared with an equivalent glucose exposure delivered directly into the circulation.

The peptide’s insulin-stimulating effect is glucose dependent. This means the effect becomes stronger as glucose rises and diminishes as glucose approaches normal or low concentrations.

Plain-English explanation: GLP-1 is one of the signals released by the digestive system after eating. It tells the pancreas and brain that nutrients have arrived and helps coordinate blood sugar, stomach movement and food intake.

GLP-1(7–36) Amide, GLP-1(7–37) and Inactive Fragments

The term GLP-1 can refer to several peptide forms with different biological activity.

Peptide Form Basic Identity Biological Meaning
GLP-1(7–36) amide Thirty-residue peptide ending in amidated arginine Predominant active circulating human form
GLP-1(7–37) Thirty-one-residue form ending in glycine Active at the GLP-1 receptor with broadly similar acute biological effects
GLP-1(9–36) amide DPP-4-cleaved metabolite missing His-Ala Very weak or inactive at the classical GLP-1 receptor
GLP-1(1–37) Longer proglucagon-derived sequence Not equivalent to the principal active incretin form
GLP-1 acetate Peptide associated with acetate counterions Salt form must be distinguished from the peptide sequence

Naturally occurring human intestinal GLP-1 was characterised as the truncated peptide corresponding to GLP-1(7–36) amide rather than the longer sequence initially predicted from proglucagon.

GLP-1(7–36) amide and GLP-1(7–37) produced broadly similar insulin, glucose and glucagon effects in controlled human experiments.

The first two residues, histidine and alanine, are essential to strong activation of the GLP-1 receptor. Removal by DPP-4 causes rapid loss of classical receptor activity.

“GLP-1” alone is an incomplete product name

A meaningful research label should state whether the material is GLP-1(7–36) amide, GLP-1(7–37), a metabolite, an analogue or another receptor agonist.

GLP-1 Research in the Peptides UK Market

The phrase GLP-1 is often used commercially without identifying the actual molecule.

Within Peptides UK search results, GLP-1 may refer to native GLP-1(7–36) amide, GLP-1(7–37), semaglutide, liraglutide, tirzepatide, retatrutide or a vaguely described “GLP-1 blend”.

These compounds differ in amino-acid sequence, receptor activity, molecular weight, duration, evidence, regulatory status and safety profile.

Some websites use the familiar names Ozempic, Wegovy or Mounjaro to promote unlicensed powder, imitation pens or products that have not been supplied through the authorised pharmaceutical chain.

Other sellers describe a research vial simply as “GLP-1 peptide” while making weight-loss claims that resemble evidence for semaglutide or tirzepatide.

Evidence from a regulated semaglutide trial cannot substantiate an unidentified native GLP-1 vial, a different analogue or an unverified imitation product.

Active ingredient, brand and indication must match

Ozempic, Wegovy and Rybelsus contain semaglutide but have product-specific indications and formulations. Mounjaro contains tirzepatide. A generic “GLP-1” label is not an adequate substitute for this information.

Native GLP-1 Compared With GLP-1 Medicines

Modern medicines were engineered to overcome the short duration of the endogenous hormone.

Feature Native GLP-1 Long-Acting GLP-1 Medicine
Origin Produced from human proglucagon Synthetic or recombinant analogue
Main active form GLP-1(7–36) amide Product-specific modified structure
Duration Minutes Hours to approximately one week, depending on the medicine
DPP-4 susceptibility Rapidly cleaved Designed to resist or avoid rapid cleavage
Albumin association Not deliberately engineered Used by liraglutide and semaglutide to extend exposure
Clinical use Primarily physiological and experimental research Authorised product-specific diabetes, weight or cardiovascular uses
Manufacturing standard Depends on research material Regulated pharmaceutical manufacture and pharmacovigilance

Liraglutide contains a fatty-acid-linked modification that promotes albumin binding and prolongs activity.

Semaglutide contains an amino-acid substitution that reduces DPP-4 cleavage and a larger fatty-diacid modification that supports prolonged albumin association.

Dulaglutide links modified GLP-1 sequences to an immunoglobulin Fc structure, creating a much larger biological medicine.

Exenatide is based on exendin-4, a 39-amino-acid peptide with GLP-1 receptor activity but a sequence distinct from native human GLP-1.

Tirzepatide was designed to activate both GIP and GLP-1 receptors. Its evidence should not be attributed to pure GLP-1 receptor agonism alone.

How the Body Produces GLP-1

One precursor protein produces different hormones depending on the tissue and processing enzymes involved.

The human GCG gene encodes preproglucagon. After removal of a signal peptide, proglucagon is processed into different peptide hormones.

In pancreatic alpha cells, prohormone convertase activity favours production of glucagon and related fragments.

In intestinal L cells and selected neurons, alternative processing generates GLP-1, GLP-2, oxyntomodulin and other proglucagon-derived peptides.

Additional enzymatic processing converts the initially translated GLP-1 region into the shorter biologically active 7–36 amide and 7–37 forms.

Amidation of GLP-1(7–36) uses the terminal glycine in the precursor as the amide-donating residue.

GCG gene and preproglucagon
Tissue-specific proglucagon processing
Intestinal L-cell active GLP-1
Nutrient-stimulated secretion after eating
Rapid DPP-4 metabolism

Native GLP-1 Molecular and Scientific Profile

Correct identity requires confirmation of the active N-terminus and C-terminal amidation.

Predominant active form

GLP-1(7–36) Amide

His Ala Glu Gly Thr Phe Thr Ser Asp Val Ser Ser Tyr Leu Glu Gly Gln Ala Ala Lys Glu Phe Ile Ala Trp Leu Val Lys Gly Arg-NH₂

The single-letter sequence is HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2.

Physiological context

Meal-Responsive Incretin Hormone

Active GLP-1 rises after nutrient ingestion and contributes to post-meal glucose and digestive regulation.

Its effects depend on glucose concentration, nutrient delivery, nervous-system signalling and receptor distribution.

Full name Glucagon-like peptide-1
Predominant active form GLP-1(7–36) amide
Amino-acid length Thirty residues
Approximate molecular mass 3,297.6 Da
N-terminal residues Histidine-alanine
C-terminal structure Amidated arginine
Protein precursor Proglucagon
Receptor GLP-1 receptor
Main degrading enzyme Dipeptidyl peptidase-4
Approximate active plasma half-life Approximately one to two minutes
Authorised native-peptide UK indication None identified

The GLP-1 Receptor and Cellular Signalling

The GLP-1 receptor is a class-B G-protein-coupled receptor rather than an enzyme or insulin receptor.

Binding of active GLP-1 changes the receptor’s conformation and activates intracellular G-protein signalling.

In pancreatic beta cells, this commonly increases cyclic AMP and activates pathways involving protein kinase A and exchange proteins directly activated by cyclic AMP.

These pathways amplify insulin granule release when glucose metabolism has already raised the beta cell’s stimulatory state.

The glucose-dependent nature of this process helps explain why GLP-1 receptor agonists generally have a lower intrinsic risk of severe hypoglycaemia than medicines that drive insulin release independently of glucose.

Hypoglycaemia can still occur, particularly when a GLP-1 medicine is combined with insulin or an insulin-secretion medicine such as a sulfonylurea.

Receptor activation is not identical across every agonist

Different GLP-1 receptor agonists vary in receptor binding, signalling bias, duration, tissue exposure and additional receptor activity. Class effects should not replace product-specific evidence.

DPP-4 and the Short Half-Life of Native GLP-1

Rapid enzymatic cleavage is the main reason native GLP-1 did not become a convenient routine medicine.

DPP-4 removes the N-terminal histidine and alanine from GLP-1(7–36) amide.

The resulting GLP-1(9–36) amide has little classical GLP-1 receptor activity compared with the intact peptide.

Human studies demonstrated rapid N-terminal degradation after both intravenous and subcutaneous administration.

Native GLP-1 infusion can improve glucose measurements, but continued exposure is required because active peptide disappears quickly.

Pharmaceutical development therefore followed two main strategies: design longer-acting receptor agonists or inhibit DPP-4 so that the body’s own incretin hormones remain active longer.

Important distinction: DPP-4 inhibitors such as sitagliptin are small-molecule medicines that preserve endogenous incretin activity. They are not GLP-1 peptides or GLP-1 receptor agonists.

GLP-1, Insulin and Blood Glucose

The insulin response is amplified when glucose is elevated.

Human clamp studies showed that GLP-1(7–36) amide enhances insulin and C-peptide secretion in healthy volunteers and in people with type 2 diabetes.

Its insulinotropic action remains relatively well preserved in type 2 diabetes compared with the impaired response to GIP found in many patients.

GLP-1 receptor agonists can reduce fasting and post-meal glucose and lower glycated haemoglobin when used appropriately in type 2 diabetes.

They do not replace insulin in type 1 diabetes and should not be used to stop or reduce prescribed insulin abruptly without clinical supervision.

Previous MHRA reviews have warned that rapid reduction or discontinuation of insulin when beginning a GLP-1 receptor agonist can contribute to diabetic ketoacidosis.

GLP-1 and Glucagon Regulation

Active GLP-1 can suppress inappropriate glucagon secretion during elevated glucose.

Glucagon is produced by pancreatic alpha cells and helps maintain blood glucose by promoting glucose release from the liver.

After meals, excessive glucagon can worsen high blood glucose in type 2 diabetes.

GLP-1 can reduce glucagon secretion when glucose is normal or high, contributing to lower hepatic glucose output.

During hypoglycaemia, protective counter-regulatory responses become more important, and GLP-1’s glucagon-suppressing effect is reduced.

Tirzepatide and future multi-receptor agonists have more complex glucagon-related effects because they activate additional receptors.

GLP-1 and Gastric Emptying

Slower delivery of food from the stomach can reduce the speed of post-meal glucose absorption.

Controlled human studies found that native GLP-1 delays gastric emptying and alters stomach accommodation.

Slower gastric emptying can reduce early post-meal glucose peaks and contribute to fullness, nausea or abdominal discomfort.

The effect is not identical for every GLP-1 medicine. Short-acting receptor agonists tend to maintain a stronger gastric-emptying effect, while tolerance can develop to part of this action during prolonged exposure to longer-acting agonists.

Delayed gastric emptying may affect the absorption of other oral medicines and can leave residual stomach contents during anaesthesia or deep sedation.

Patients should tell surgical and anaesthetic teams when they are using a GLP-1 or dual GIP/GLP-1 medicine.

These medicines do not merely “switch off hunger”

Their effects involve glucose-dependent pancreatic signalling, gastrointestinal motility, central appetite pathways and learned eating behaviour. The balance differs between individuals and medicines.

GLP-1, Appetite, Satiety and Food Intake

Native GLP-1 and long-acting receptor agonists can reduce energy intake under controlled conditions.

Infusion studies in people with obesity reported lower hunger and food intake during active GLP-1 exposure.

Semaglutide and liraglutide studies have reported changes in appetite, cravings, control of eating and energy intake.

Reduced appetite does not mean that food intake becomes medically optional. Adequate protein, micronutrients, fluid and fibre remain important during medically supervised weight management.

Rapid or substantial weight reduction can include loss of lean tissue as well as fat mass.

Treatment therefore requires attention to nutrition, resistance activity where suitable, frailty, medication interactions and the underlying reason for weight management.

GLP-1 and Related Medicines Authorised in the UK

The list and exact indications are product specific and were checked on 22 July 2026.

Active Substance Type Selected UK Product Context Important Distinction
Liraglutide Acylated human GLP-1 analogue Product-specific type 2 diabetes and weight-management uses Victoza and Saxenda have different authorised purposes
Dulaglutide Modified GLP-1-Fc fusion protein Type 2 diabetes Much larger molecule than native GLP-1
Semaglutide Long-acting acylated GLP-1 analogue Product-specific diabetes, weight-management and cardiovascular-risk uses Ozempic, Rybelsus and Wegovy are not interchangeable brand claims
Tirzepatide Dual GIP and GLP-1 receptor agonist Type 2 diabetes and weight management Not a pure GLP-1 analogue
Exenatide Exendin-4-based GLP-1 receptor agonist Authorised historically for type 2 diabetes MHRA stated in January 2026 that it was no longer marketed in the UK
Lixisenatide Exendin-4-derived GLP-1 receptor agonist Previously authorised for type 2 diabetes MHRA stated in January 2026 that it was no longer authorised in the UK
Native GLP-1 Human GLP-1(7–36) amide or GLP-1(7–37) No routine authorised medicinal use identified Rapidly degraded and not equivalent to the medicines above

Ozempic is not the generic name for every weight-loss injection

Ozempic contains semaglutide and is authorised for specified type 2 diabetes uses. Wegovy is the semaglutide product authorised for specified weight-management and cardiovascular-risk indications.

GLP-1 Receptor Agonists in Type 2 Diabetes

The class has a substantial evidence base, but treatment selection remains individual and product specific.

Large clinical programmes have shown reductions in glycated haemoglobin, fasting glucose and post-meal glucose with authorised GLP-1 receptor agonists.

Many participants also experience weight reduction, although the average amount differs between active substances, exposure levels and populations.

Several cardiovascular-outcome trials showed that particular GLP-1 receptor agonists reduce major cardiovascular events in high-risk people with type 2 diabetes.

In the LEADER trial, liraglutide reduced the composite of cardiovascular death, non-fatal myocardial infarction or non-fatal stroke compared with placebo in people with type 2 diabetes and high cardiovascular risk.

Semaglutide and dulaglutide have their own cardiovascular and renal evidence bases. The existence of a class effect does not mean every endpoint is identical across products.

Clinical selection may depend on cardiovascular disease, kidney function, body weight, gastrointestinal tolerance, other medicines, pregnancy potential and access within the NHS or private sector.

GLP-1 Medicines and Weight-Management Evidence

Semaglutide, liraglutide and tirzepatide have controlled human evidence, unlike unidentified research-market GLP-1 products.

STEP 1

Semaglutide

The STEP 1 trial enrolled 1,961 adults with overweight or obesity without diabetes.

Semaglutide alongside lifestyle intervention produced an average body-weight reduction of approximately 15% over 68 weeks, compared with approximately 2.4% with placebo.

SURMOUNT-1

Tirzepatide

The SURMOUNT-1 trial enrolled more than 2,500 adults with overweight or obesity without diabetes.

Tirzepatide produced substantial dose-dependent weight reduction over 72 weeks. It is a dual GIP and GLP-1 receptor agonist rather than evidence for native GLP-1 alone.

SCALE programme

Liraglutide

Liraglutide has controlled evidence for weight management when combined with dietary and physical-activity support.

Its average effect is generally lower than that seen in semaglutide and tirzepatide obesity trials, but comparisons across separate trials require caution.

NICE access

Eligibility Is Restricted

NICE recommendations use specific clinical eligibility criteria and service arrangements.

Marketing authorisation does not mean that every person is eligible for NHS treatment or that treatment is appropriate for cosmetic weight loss.

Clinical trials use verified medicines, defined support programmes, monitoring procedures and prespecified outcomes.

These findings cannot be transferred to an unknown powder, compounded imitation or product containing a different receptor agonist.

GLP-1 Medicines and Cardiovascular Outcomes

Some medicines provide benefits that extend beyond glucose or body-weight measurements.

People With Type 2 Diabetes

Cardiovascular-outcome trials involving liraglutide, semaglutide and dulaglutide have reported reductions in major cardiovascular events in selected populations.

These trials involved thousands of participants and compared active medicine with placebo in addition to usual care.

SELECT Trial

SELECT enrolled more than 17,000 adults with established cardiovascular disease and overweight or obesity who did not have diabetes.

Major adverse cardiovascular events occurred in 6.5% of participants assigned to semaglutide and 8.0% assigned to placebo, representing a 20% relative reduction in the primary composite outcome.

The trial did not establish that every GLP-1 receptor agonist or every weight-loss product produces the same cardiovascular effect.

Current NICE Position

In May 2026, NICE published technology-appraisal guidance on semaglutide for reducing the risk of major adverse cardiovascular events in adults with established cardiovascular disease and overweight or obesity.

Weight change is not the only endpoint

Cardiovascular outcomes depend on baseline disease, treatment duration, blood pressure, lipids, inflammation, glycaemia and other mechanisms. The benefit cannot be reduced to a simple claim that weight loss alone prevents every event.

What Happens When GLP-1 Weight Treatment Stops?

Weight-regulation biology commonly reasserts itself after treatment is withdrawn.

Randomised withdrawal studies show that continued semaglutide treatment supports continued or maintained weight reduction, while people switched to placebo commonly regain weight.

This does not mean that treatment must continue indefinitely for every patient. It means obesity should be approached as a chronic, relapsing condition rather than a temporary failure of willpower.

Decisions about continuation, switching or stopping should consider treatment response, adverse effects, health goals, pregnancy plans, access and alternative management options.

Stopping treatment does not justify replacing an authorised medicine with an unverified research peptide.

GLP-1 Peptide Evidence at a Glance

Established physiology should be separated from product-specific clinical evidence.

Research Question Evidence Type Current Finding Main Limitation
Is GLP-1 a natural human peptide? Biochemical isolation and sequence research Yes Commercial analogues are structurally different
What is the main active form? Human intestinal and plasma research GLP-1(7–36) amide Assays can confuse active peptide with metabolites
Does native GLP-1 increase insulin? Controlled human studies Yes, in a glucose-dependent manner Requires continuing exposure because of rapid degradation
Does native GLP-1 suppress glucagon? Human physiological research Yes, particularly when glucose is elevated Effect is glucose and context dependent
Does GLP-1 delay gastric emptying? Controlled human studies Yes Magnitude varies by agonist and treatment duration
Does GLP-1 reduce food intake? Infusion and medicine trials Reduced intake reported Does not eliminate nutritional requirements
Do authorised agonists improve type 2 diabetes? Large randomised clinical programmes Yes, for specific products and patients Not appropriate for every patient or product
Can semaglutide support weight management? Large phase-three trials Yes, during treatment with lifestyle support Adverse effects, eligibility and regain after stopping matter
Can tirzepatide support weight management? Large phase-three trials Yes It is a dual GIP and GLP-1 agonist
Can semaglutide reduce cardiovascular events? SELECT and other outcome trials Yes, in defined high-risk populations Cannot be generalised to every agonist or patient
Is native GLP-1 a practical weekly medicine? Pharmacokinetic research No Active half-life is approximately one to two minutes
Is a generic research GLP-1 vial equivalent to semaglutide? Chemical and pharmaceutical comparison No Different sequence, modifications and manufacturing controls
Are GLP-1 medicines risk free? Clinical trials and pharmacovigilance No Gastrointestinal, pancreatic and other risks require monitoring

Important GLP-1 Research and Interpretation Limitations

A large evidence base can still be misrepresented through inaccurate comparisons.

  • Native GLP-1 and long-acting receptor agonists are not interchangeable.
  • GLP-1(7–36) amide and GLP-1(7–37) require separate analytical identification.
  • Total GLP-1 assays may include inactive metabolites.
  • Blood GLP-1 measurements are highly sensitive to sample handling and DPP-4 activity.
  • Evidence from semaglutide cannot validate every GLP-1 receptor agonist.
  • Evidence from tirzepatide includes GIP-receptor activity.
  • Diabetes and obesity product indications differ.
  • Brand names should not be used as generic class names.
  • Weight-management trials include structured lifestyle support.
  • Average trial results do not predict every individual response.
  • Short trials do not establish lifelong safety.
  • Weight reduction can include lean tissue as well as fat.
  • Rapid weight loss can affect gallstone risk and nutrition.
  • Gastrointestinal adverse effects can cause dehydration.
  • Delayed gastric emptying can affect surgery and oral medicines.
  • Hypoglycaemia risk changes when insulin or sulfonylureas are used.
  • Stopping treatment commonly leads to some weight regain.
  • NHS eligibility is narrower than broad commercial advertising.
  • Private prescription does not remove the need for clinical assessment.
  • Research-market products may contain a different active ingredient.
  • Counterfeit pens may closely resemble authentic packaging.
  • A purity percentage cannot establish pharmaceutical equivalence.
  • Native GLP-1 potency does not prove long-acting analogue potency.
  • Receptor assays do not establish clinical safety.
  • Unauthorised products lack a mature pharmacovigilance system.

How GLP-1 Research Material Should Be Analytically Tested

Testing must identify the exact peptide rather than confirming only that a peak is present.

Exact identity

Intact Molecular Mass

High-resolution mass spectrometry should distinguish native GLP-1 from semaglutide, liraglutide, tirzepatide and shorter degradation products.

Sequence

Tandem Mass Spectrometry

Fragment-ion evidence should support every amino-acid residue and the correct order.

Active N-terminus

His-Ala Confirmation

Testing should confirm that native active GLP-1 has not been converted substantially into GLP-1(9–36) amide.

Terminal structure

C-Terminal Amidation

GLP-1(7–36) amide must be distinguished from GLP-1(7–37), non-amidated products and truncated forms.

Analogue modification

Acylation and Substitutions

Semaglutide and liraglutide require confirmation of fatty-acid attachment sites and amino-acid substitutions.

Quantity

Net Peptide Assay

Active content should be measured independently of water, salts, buffers and total dried mass.

Biological activity

GLP-1 Receptor Potency

A validated cell-based assay can assess receptor activation, but it does not replace chemical identity testing.

Stability

Degradation and Aggregation

Stability testing should assess cleavage, oxidation, deamidation, aggregation and loss of potency throughout storage.

What a Meaningful Native GLP-1 Certificate Should Include

  • Complete GLP-1 form, such as GLP-1(7–36) amide
  • Full amino-acid sequence
  • Confirmation of the N-terminal histidine-alanine sequence
  • Confirmation of C-terminal amidation or terminal glycine
  • Observed intact molecular mass
  • Tandem-MS sequence evidence
  • Quantitative net peptide assay
  • GLP-1(9–36) amide result
  • Other N-terminal truncation results
  • Oxidation and deamidation profile
  • Chromatographic purity
  • Aggregate assessment
  • Counterion content
  • Water-content result
  • Residual-solvent results
  • Receptor-potency assay where relevant
  • Finished-product stability data
  • Batch number and testing-laboratory identity
  • Analytical methods and acceptance criteria
  • A clear statement of tests not performed

Why “99% HPLC” Is Not Enough

A single HPLC result does not reveal whether the main peak is native GLP-1, semaglutide, a degradation product or another peptide with similar retention behaviour.

It does not confirm N-terminal activity, amidation, fatty-acid modification, receptor potency, net content, aggregation or sterile-product quality.

A research certificate cannot establish equivalence to an authorised pen or tablet without extensive comparative chemistry, manufacturing, pharmacokinetic and clinical evidence.

A molecular-weight match alone is insufficient

Peptides with incorrect stereochemistry, terminal groups or residue order may have similar nominal mass. Identity should be supported by orthogonal analytical methods.

GLP-1 Medicine Safety and Adverse Effects

Authorised medicines have established benefits, but treatment is not risk free.

Gastrointestinal Effects

Nausea, vomiting, diarrhoea, constipation, abdominal discomfort and reduced appetite are among the most frequently reported adverse effects.

Symptoms are often more prominent during treatment initiation or exposure increases.

Persistent vomiting or diarrhoea can cause dehydration and may worsen kidney function.

Gallbladder and Biliary Disease

Gallstones and gallbladder inflammation have been reported during GLP-1 receptor-agonist treatment.

Rapid weight loss itself can increase gallstone risk, making causal interpretation more complex.

Hypoglycaemia

Used alone, GLP-1 receptor agonists have a relatively low intrinsic risk of severe hypoglycaemia because insulin stimulation is glucose dependent.

Risk rises when they are combined with insulin or sulfonylureas.

Delayed Gastric Emptying

Delayed stomach emptying may worsen symptoms in people with severe gastrointestinal-motility disorders.

Residual gastric contents can also create a pulmonary-aspiration risk during general anaesthesia or deep sedation.

Semaglutide and NAION

In February 2026, the MHRA stated that semaglutide may be very rarely associated with non-arteritic anterior ischaemic optic neuropathy.

Sudden painless loss of vision or rapidly worsening eyesight requires urgent medical assessment.

Mental-Health Review

Following a comprehensive safety review, the MHRA concluded that available evidence did not support a causal association between GLP-1 medicines and depression, suicidal ideation or suicide.

Monitoring continues, and any serious mood or behavioural change still requires appropriate clinical attention.

Research-Product Risks

  • Incorrect active ingredient
  • Incorrect concentration
  • Native GLP-1 substituted for a long-acting analogue
  • Semaglutide substituted with another peptide
  • Incorrect amino-acid sequence
  • Incorrect acylation or linker structure
  • Peptide degradation
  • Peptide aggregates
  • Unverified sterility
  • Unverified bacterial-endotoxin control
  • Incorrect preservatives or excipients
  • Counterfeit pen components
  • Uncontrolled storage temperature
  • Reused or fabricated certificates
  • No reliable adverse-event reporting system

MHRA’s 2026 Acute-Pancreatitis Warning

Product information across the class was strengthened following reports of severe cases.

Acute pancreatitis is inflammation of the pancreas and can become life threatening.

In January 2026, the MHRA strengthened warnings for dulaglutide, exenatide, liraglutide, semaglutide and tirzepatide.

The update highlighted rare reports of severe acute pancreatitis, including necrotising and fatal cases.

Severe, persistent abdominal pain that may spread to the back, particularly with nausea or vomiting, requires urgent medical assessment.

Gastrointestinal symptoms are common during treatment, but persistent severe pain should not be dismissed as expected nausea.

Pancreatitis cannot be diagnosed from symptoms alone

Similar symptoms can result from gallstones, stomach disease, liver disease and other emergencies. Appropriate clinical examination and testing are required.

GLP-1 Medicines, Pregnancy and Contraception

These medicines should not be used during pregnancy, while trying to conceive or during breastfeeding unless official product information states otherwise.

Human pregnancy-safety information remains limited, and animal reproductive findings have contributed to precautionary restrictions.

The MHRA advises effective contraception while using GLP-1 medicines and for the product-specific period after treatment is stopped.

Tirzepatide may reduce the effectiveness of oral contraceptives during treatment initiation and after exposure increases because delayed gastric emptying can affect absorption.

The MHRA advises additional barrier contraception or a non-oral contraceptive method during relevant periods when using tirzepatide.

Anyone who becomes pregnant while using a GLP-1 medicine should contact an appropriate healthcare professional promptly.

Illegal, Counterfeit and Falsified GLP-1 Products

High demand has created a substantial criminal and unauthorised supply market.

All GLP-1 medicines used for weight management are prescription-only in the UK.

They should be supplied only following an appropriate assessment by a qualified prescriber and through a regulated pharmacy or healthcare service.

The MHRA reported seizing more than 5,000 illegally traded GLP-1 products during 2025 and disrupted facilities suspected of manufacturing unlicensed weight-loss medicines.

In February 2026, the regulator warned about falsified Mounjaro KwikPens supplied through a UK online pharmacy.

Counterfeit medicines may contain an incorrect active ingredient, an incorrect amount, no active ingredient or harmful contaminants.

Packaging photographs and a printed batch number are not enough to establish authenticity.

Do not rely on social-media testimonials

A positive weight-loss account cannot confirm the contents, sterility, dose accuracy or long-term safety of a product.

GLP-1 Regulation in the Peptides UK Market

Regulatory information checked on 22 July 2026.

Authorised Medicines and Unauthorised Peptides Are Different Categories

Liraglutide, dulaglutide, semaglutide and tirzepatide are authorised in the UK through specific medicinal products and indications.

Native GLP-1(7–36) amide and unidentified “GLP-1 peptide” research vials do not acquire authorisation because related receptor agonists are licensed.

Authorisation applies to the approved active substance, formulation, strength, manufacturing process, packaging, indication and patient information.

Prescription-Only Status

GLP-1 and dual GIP/GLP-1 medicines used for diabetes or weight management are prescription-only medicines.

Sale without an appropriate prescription and regulated supply pathway can be illegal and unsafe.

Medicinal Claims

A product may be classified as medicinal where it is presented as treating obesity, diabetes, high blood glucose, cardiovascular disease or another condition.

It may also be medicinal where it is intended to modify appetite, insulin secretion, gastric emptying or body weight through pharmacological action.

A “Research Use Only” label does not settle the legal position where the surrounding content promotes personal administration.

Advertising Restrictions

Prescription-only medicines cannot be advertised to the general public in the same way as ordinary consumer products.

Unauthorised medicinal products are subject to additional restrictions under the Human Medicines Regulations.

This section provides general regulatory education and does not constitute legal advice.

NICE Guidance for GLP-1 and Related Weight Medicines

NICE recommendations concern NHS use and are narrower than broad online advertising.

Semaglutide for Weight Management

NICE technology-appraisal guidance TA875 recommends Wegovy as an option for specified adults with overweight or obesity, alongside a reduced-calorie diet and increased physical activity.

The recommendation includes clinical eligibility criteria, weight-related comorbidity requirements and specialist-service conditions.

Liraglutide for Weight Management

NICE TA664 recommends liraglutide for a restricted high-risk group within specialist weight-management services.

Tirzepatide for Weight Management

NICE TA1026 recommends tirzepatide for eligible adults alongside dietary and physical-activity support.

NHS implementation is being phased, with earlier access prioritised for people at greatest clinical risk.

Semaglutide for Cardiovascular-Risk Reduction

NICE TA1152, published in May 2026, addresses semaglutide for reducing major adverse cardiovascular events in eligible adults with established cardiovascular disease and overweight or obesity.

Authorisation, NICE recommendation and local availability are not identical

A medicine can be authorised but subject to narrower NHS funding criteria, phased implementation, local prescribing pathways or specialist assessment requirements.

GLP-1 Medicines and Competitive Sport

Athletes should check the exact medicine and current rules rather than relying on class assumptions.

GLP-1 receptor agonists were not identified by name as prohibited substances in the 2026 WADA Prohibited List reviewed for this article.

This does not guarantee that every combined product, administration method or additional ingredient is permitted.

Intravenous infusion rules can apply independently of the active ingredient.

Weight reduction, dehydration, inadequate nutrition and gastrointestinal adverse effects can also affect health and sporting performance.

Athletes should check the exact medicine through Global DRO, UK Anti-Doping or their international federation.

Common GLP-1 Peptide Claims Examined

Accurate statements require identification of the precise hormone, analogue, medicine and indication.

The claim

“GLP-1 and Ozempic are the same thing.”

Ozempic contains semaglutide, a modified GLP-1 analogue.

Native GLP-1 is a short-lived human hormone with a different sequence and pharmacokinetic profile.

The claim

“Mounjaro is a GLP-1 peptide.”

Tirzepatide activates the GLP-1 receptor.

It also activates the GIP receptor and is therefore a dual agonist rather than native GLP-1 or a pure GLP-1 analogue.

The claim

“All GLP-1 medicines have the same effect.”

They share receptor activity.

They differ in sequence, duration, receptor profile, clinical outcomes, indications and adverse-effect data.

The claim

“GLP-1 injections melt fat directly.”

Weight reduction is influenced mainly through appetite, food intake, glucose regulation and related physiological effects.

The medicines do not selectively dissolve fat from a chosen body area.

The claim

“You do not need to eat while using a GLP-1.”

Appetite can fall substantially.

Adequate nutrition, hydration and preservation of muscle remain essential.

The claim

“GLP-1 medicines never cause hypoglycaemia.”

Their intrinsic risk is relatively low because insulin stimulation is glucose dependent.

Hypoglycaemia can occur, particularly with insulin or sulfonylureas.

The claim

“Nausea proves the medicine is working.”

Nausea is a common adverse effect.

It is not a validated measure of effectiveness and can become medically significant when persistent or severe.

The claim

“GLP-1 medicines are only appetite suppressants.”

Appetite effects are important.

The class also affects insulin, glucagon, gastric emptying and cardiovascular or metabolic outcomes.

The claim

“Ozempic is approved for cosmetic weight loss.”

Ozempic is a semaglutide product authorised for specified type 2 diabetes uses.

MHRA guidance states that GLP-1 medicines should not be used simply for aesthetic or cosmetic weight reduction.

The claim

“A generic GLP-1 vial is equivalent to Wegovy.”

Wegovy contains a defined semaglutide formulation produced under regulated pharmaceutical controls.

Native GLP-1 or an unidentified research peptide is not equivalent.

The claim

“A 99% HPLC certificate proves semaglutide authenticity.”

HPLC purity is one analytical measure.

It does not prove sequence, fatty-acid linkage, potency, concentration, sterility, device accuracy or pharmaceutical equivalence.

The claim

“Once weight is lost, it cannot return.”

Continued treatment can support weight maintenance.

Clinical studies show that weight regain commonly occurs after treatment withdrawal.

Native GLP-1 Compared With Related Compounds

Similar metabolic effects do not mean identical chemistry or regulatory status.

Compound Basic Identity Main Receptor Activity Important Distinction
Native GLP-1 Thirty-residue human incretin peptide GLP-1 receptor Active half-life measured in minutes
Semaglutide Acylated modified GLP-1 analogue GLP-1 receptor Long acting with product-specific authorised uses
Liraglutide Acylated modified GLP-1 analogue GLP-1 receptor Shorter duration than semaglutide
Dulaglutide GLP-1 analogue fused to an Fc structure GLP-1 receptor Large recombinant fusion medicine
Exenatide Exendin-4-based peptide GLP-1 receptor Not based directly on the human GLP-1 sequence
Tirzepatide Modified 39-residue peptide GIP and GLP-1 receptors Dual agonist rather than pure GLP-1 agonist
DPP-4 inhibitors Oral small-molecule medicines Block incretin degradation Not peptides and do not directly activate GLP-1 receptors
Insulin Pancreatic peptide hormone Insulin receptor Different hormone with direct glucose-lowering activity
Glucagon Proglucagon-derived peptide hormone Glucagon receptor Generally raises rather than lowers blood glucose

How to Assess GLP-1 and Peptides UK Evidence Critically

Use this checklist before accepting scientific, medicinal or product-quality claims.

  • Does the source identify the exact active substance?
  • Is it native GLP-1, semaglutide, liraglutide or tirzepatide?
  • Is GLP-1(7–36) amide distinguished from GLP-1(7–37)?
  • Is the N-terminal histidine-alanine sequence intact?
  • Is C-terminal amidation confirmed?
  • Is the product an analogue or receptor co-agonist?
  • Are fatty-acid modifications identified?
  • Was intact mass confirmed?
  • Was sequence confirmed by tandem mass spectrometry?
  • Was receptor potency measured?
  • Was net active-peptide content measured?
  • Were aggregates and degradation products assessed?
  • Does the certificate match the finished batch?
  • Was the product manufactured as a medicine or research reagent?
  • Does the cited trial use the same active substance?
  • Does the cited trial use the same route and formulation?
  • Was the trial conducted in diabetes, obesity or healthy volunteers?
  • Was the outcome glycated haemoglobin, weight or cardiovascular events?
  • Was the trial randomised and placebo controlled?
  • How long did treatment continue?
  • What happened after treatment stopped?
  • Were gastrointestinal discontinuations reported?
  • Were pancreatitis and gallbladder events assessed?
  • Were insulin and sulfonylurea combinations considered?
  • Was pregnancy excluded?
  • Is tirzepatide being described accurately as a dual agonist?
  • Is Ozempic evidence being used to sell a non-semaglutide product?
  • Is FDA or MHRA approval being transferred to an unauthorised vial?
  • Is NHS eligibility being confused with general availability?
  • Is the source selling the product it describes?

Medical and Editorial Review

This final article has been reviewed for medical context, evidence presentation, patient safety language and editorial clarity by the multidisciplinary panel below.

The reviewers and contributors are identified to provide clear authorship and accountability. Their inclusion does not represent endorsement of any research product, supplier, personal use, treatment claim or commercial statement discussed in this article.

Dr Laura Geige
Medical Director and Clinical Reviewer

Dr Laura Geige

Medical Director and Senior Aesthetics Practitioner at It’s Me & You Clinic, with a background in dentistry, medical aesthetics and cosmetic dermatology.

Dr Rimas Geiga
Medical and Nutritional Sciences Reviewer

Dr Rimas Geiga

Medical doctor with a special interest in nutritional sciences, dietology, metabolic health and evidence based preventative care.

Dr Snieguole Geige
Medical and Healthcare Reviewer

Dr Snieguole Geige

Dentist and medical doctor with experience across healthcare, preventative medicine and patient centred clinical standards.

Dr Giedre Narkiene
Dermatology Reviewer

Dr Giedre Narkiene

Medical doctor and board certified dermatologist with expertise in medical and cosmetic dermatology, skin health and patient safety.

Dr Veronika Matutyte
Medical and Gerontology Reviewer

Dr Veronika Matutyte

Medical doctor with training and professional experience in gerontology and healthcare management across clinical and hospital settings.

Livija Samušienė
Cosmetology and Skin Health Contributor

Livija Samušienė

Qualified cosmetologist with a Bachelor of Health Sciences in cosmetology and a professional interest in skin health, acne and evidence based aesthetic care.

GLP-1 Peptide UK Frequently Asked Questions

Evidence-led answers about native GLP-1, receptor agonists, weight management, safety and UK regulation.

What does GLP-1 stand for?

GLP-1 stands for glucagon-like peptide-1.

Is GLP-1 a peptide hormone?

Yes. Its predominant active form, GLP-1(7–36) amide, contains 30 amino-acid residues.

Where is GLP-1 produced?

It is produced through proglucagon processing, particularly in intestinal L cells and selected neurons.

What is the native GLP-1 sequence?

GLP-1(7–36) amide has the sequence HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2.

What is GLP-1(7–37)?

It is an active 31-amino-acid form ending in glycine rather than amidated arginine.

What does GLP-1 do?

It enhances glucose-dependent insulin secretion, can suppress glucagon, delays gastric emptying and contributes to appetite and food-intake regulation.

How long does native GLP-1 last?

Active native GLP-1 has a plasma half-life of approximately one to two minutes because it is rapidly cleaved by DPP-4 and cleared.

Is GLP-1 the same as semaglutide?

No. Semaglutide is a modified, long-acting analogue designed to activate the GLP-1 receptor.

Is Ozempic the same as Wegovy?

Both contain semaglutide, but they are different medicinal products with product-specific authorised indications, presentations and prescribing information.

Is Mounjaro a GLP-1 receptor agonist?

Tirzepatide activates the GLP-1 receptor, but it also activates the GIP receptor and is classified as a dual GIP and GLP-1 receptor agonist.

Do GLP-1 medicines help with type 2 diabetes?

Authorised products have strong evidence for improving glucose control in appropriate people with type 2 diabetes.

Do GLP-1 medicines cause weight loss?

Semaglutide, liraglutide and tirzepatide have controlled clinical evidence for weight reduction in eligible patients during treatment.

Does native GLP-1 cause the same weight loss as Wegovy?

This has not been established. Native GLP-1 is degraded within minutes and is not equivalent to long-acting semaglutide.

Can GLP-1 medicines reduce cardiovascular risk?

Certain products have reduced major cardiovascular events in defined high-risk populations. The evidence is medicine and indication specific.

What did the SELECT trial show?

Semaglutide reduced major cardiovascular events by 20% relative to placebo in adults with established cardiovascular disease and overweight or obesity without diabetes.

What are common GLP-1 medicine side effects?

Common effects include nausea, vomiting, diarrhoea, constipation, abdominal discomfort and reduced appetite.

Can GLP-1 medicines cause pancreatitis?

Acute pancreatitis is an uncommon recognised risk. In January 2026, the MHRA strengthened warnings concerning rare severe, necrotising and fatal cases.

Can semaglutide affect vision?

The MHRA states that semaglutide may be very rarely associated with NAION, which can cause sudden painless visual loss.

Can GLP-1 medicines cause hypoglycaemia?

The intrinsic risk is relatively low when used alone, but it rises when treatment is combined with insulin or sulfonylureas.

Can GLP-1 medicines be used during pregnancy?

MHRA guidance states that they should not be used during pregnancy, while trying to become pregnant or while breastfeeding.

Does tirzepatide affect oral contraception?

It may reduce oral-contraceptive absorption during treatment initiation and after exposure increases. Current MHRA advice includes temporary barrier or non-oral contraception.

Do GLP-1 medicines cause suicidal thoughts?

Following a comprehensive review, the MHRA concluded that available evidence did not support a causal association with depression, suicidal ideation or suicide.

What happens when semaglutide is stopped?

Weight regain is common after treatment withdrawal, although the amount varies between individuals.

Are GLP-1 medicines prescription only in the UK?

Yes. They should be supplied only after an appropriate assessment and through a regulated prescription and pharmacy pathway.

Is a research GLP-1 vial equivalent to Ozempic?

No. Ozempic is a regulated semaglutide medicine with defined pharmaceutical quality, formulation and prescribing information.

Are fake GLP-1 pens found in the UK?

Yes. The MHRA has seized illegal GLP-1 products and issued a February 2026 warning about falsified Mounjaro pens.

Does 99% HPLC prove a GLP-1 product is genuine?

No. It does not prove the exact sequence, analogue modification, receptor potency, content, sterility or pharmaceutical equivalence.

What should a native GLP-1 certificate include?

It should include the exact peptide form, sequence, intact mass, N-terminal identity, C-terminal amidation, assay, degradation products, impurities, aggregates and batch information.

Are GLP-1 medicines prohibited in sport?

They were not identified by name on the reviewed 2026 WADA list, but athletes should check the exact product and method through Global DRO or UK Anti-Doping.

Does this article provide dosing or injection instructions?

No. It does not provide prescribing, dose escalation, reconstitution, injection, switching, combining or self-experimentation guidance.

Key Takeaways

  • GLP-1 is a naturally produced peptide hormone derived from proglucagon.
  • The predominant active form is the 30-residue GLP-1(7–36) amide.
  • GLP-1(7–37) is a related active 31-residue form.
  • DPP-4 rapidly converts active GLP-1 into GLP-1(9–36) amide.
  • Native GLP-1 has an active plasma half-life of approximately one to two minutes.
  • GLP-1 increases insulin secretion in a glucose-dependent manner.
  • It can suppress glucagon, slow gastric emptying and reduce food intake.
  • Semaglutide and liraglutide are modified long-acting GLP-1 analogues.
  • Dulaglutide is a large GLP-1-based fusion medicine.
  • Tirzepatide is a dual GIP and GLP-1 receptor agonist.
  • Authorised medicines have strong product-specific evidence for type 2 diabetes and weight management.
  • Selected medicines also reduce major cardiovascular events in defined populations.
  • NICE access criteria are narrower than general marketing authorisation.
  • Weight regain commonly occurs after treatment withdrawal.
  • Common adverse effects are gastrointestinal.
  • Rare severe pancreatitis is a recognised class warning.
  • Semaglutide carries a very rare NAION warning.
  • GLP-1 medicines should not be used during pregnancy or breastfeeding.
  • Illegal and falsified GLP-1 products have been found in the UK.
  • A research vial marked GLP-1 is not equivalent to Ozempic, Wegovy or Mounjaro.
  • A purity percentage alone cannot establish identity, potency or pharmaceutical quality.

Relevant It’s Me & You Clinic Peptides UK Resources

Explore related evidence-led articles and contributor profiles.

Retatrutide Peptide UK

Explore an investigational multi-receptor agonist activating GLP-1, GIP and glucagon receptors.

Browse related peptide guides

References

  1. UniProt. Human proglucagon, GCG, accession P01275. UniProt proglucagon record
  2. Orskov C, Holst JJ, Knuhtsen S, Baldissera FGA, Poulsen SS, Nielsen OV. Glucagon-like peptides GLP-1 and GLP-2, predicted products of the glucagon gene, are secreted separately from pig small intestine but not pancreas. Endocrinology. 1986. PubMed record
  3. Kreymann B, Williams G, Ghatei MA, Bloom SR. Glucagon-like peptide-1 7–36: a physiological incretin in man. Lancet. 1987;2(8571):1300–1304. PMID: 2890903. PubMed record
  4. Wettergren A, Schjoldager B, Mortensen PE, Myhre J, Christiansen J, Holst JJ. Truncated GLP-1 prohibits gastric and pancreatic functions in man. Digestive Diseases and Sciences. 1993. PubMed search record
  5. Orskov C, Wettergren A, Holst JJ. Biological effects and metabolic rates of GLP-1(7–36) amide and GLP-1(7–37) in healthy subjects are indistinguishable. Diabetes. 1993;42(5):658–661. PMID: 8482423. PubMed record
  6. Deacon CF, Nauck MA, Toft-Nielsen M, Pridal L, Willms B, Holst JJ. Both subcutaneously and intravenously administered GLP-1 are rapidly degraded from the amino terminus in people with type 2 diabetes and healthy subjects. Diabetes. 1995;44(9):1126–1131. PMID: 7657039. PubMed record
  7. Mentlein R, Gallwitz B, Schmidt WE. DPP-IV hydrolyses gastric inhibitory polypeptide, GLP-1(7–36) amide, peptide histidine methionine and is responsible for their degradation in human serum. European Journal of Biochemistry. 1993. PubMed search record
  8. Nauck MA, Bartels E, Orskov C, Ebert R, Creutzfeldt W. Additive insulinotropic effects of exogenous synthetic human GIP and GLP-1 in people with type 2 diabetes. Diabetologia. 1993. PMID: 8423228. PubMed record
  9. Flint A, Raben A, Astrup A, Holst JJ. GLP-1 promotes satiety and suppresses energy intake in humans. Journal of Clinical Investigation. 1998. PubMed search record
  10. Gutzwiller JP, Göke B, Drewe J, et al. Glucagon-like peptide-1 increases the period of postprandial satiety and slows gastric emptying in obese men. American Journal of Clinical Nutrition. 1999. PMID: 10193877. PubMed record
  11. Delgado-Aros S, Kim DY, Burton DD, et al. Effect of GLP-1 on gastric volume, emptying, maximum volume ingested and postprandial symptoms in humans. American Journal of Physiology. 2002. PMID: 11841992. PubMed record
  12. Zander M, Madsbad S, Madsen JL, Holst JJ. Effect of six-week continuous GLP-1 treatment on glycaemic control, insulin sensitivity and beta-cell function in type 2 diabetes. Lancet. 2002. PubMed search record
  13. Marso SP, Daniels GH, Brown-Frandsen K, et al. Liraglutide and cardiovascular outcomes in type 2 diabetes. New England Journal of Medicine. 2016;375:311–322. PMID: 27295427. PubMed record
  14. Wilding JPH, Batterham RL, Calanna S, et al. Once-weekly semaglutide in adults with overweight or obesity. New England Journal of Medicine. 2021;384:989–1002. PMID: 33567185. PubMed record
  15. Rubino D, Abrahamsson N, Davies M, et al. Effect of continued weekly semaglutide versus placebo on weight-loss maintenance. JAMA. 2021;325(14):1414–1425. PMID: 33755728. PubMed record
  16. Jastreboff AM, Aronne LJ, Ahmad NN, et al. Tirzepatide once weekly for the treatment of obesity. New England Journal of Medicine. 2022;387:205–216. PMID: 35658024. PubMed record
  17. Lincoff AM, Brown-Frandsen K, Colhoun HM, et al. Semaglutide and cardiovascular outcomes in obesity without diabetes. New England Journal of Medicine. 2023;389:2221–2232. PMID: 37952131. PubMed record
  18. Medicines and Healthcare products Regulatory Agency. GLP-1 medicines for weight loss and diabetes: what you need to know. Updated February 2026. MHRA patient guidance
  19. Medicines and Healthcare products Regulatory Agency. GLP-1 receptor agonists and dual GLP-1/GIP receptor agonists: strengthened warnings on acute pancreatitis. 29 January 2026. MHRA Drug Safety Update
  20. Medicines and Healthcare products Regulatory Agency. Semaglutide: risk of non-arteritic anterior ischaemic optic neuropathy. February 2026. MHRA Drug Safety Update
  21. Medicines and Healthcare products Regulatory Agency. Women using GLP-1 medicines must use effective contraception. June 2025. MHRA pregnancy guidance
  22. Medicines and Healthcare products Regulatory Agency. Falsified Mounjaro KwikPen 15 mg pre-filled pens. February 2026. MHRA falsified-medicine warning
  23. Medicines and Healthcare products Regulatory Agency. MHRA seizes illegal medicines worth almost £45 million in 2025. January 2026. MHRA enforcement update
  24. National Institute for Health and Care Excellence. Semaglutide for managing overweight and obesity, TA875. NICE TA875
  25. National Institute for Health and Care Excellence. Liraglutide for managing overweight and obesity, TA664. NICE TA664
  26. National Institute for Health and Care Excellence. Tirzepatide for managing overweight and obesity, TA1026. NICE TA1026
  27. National Institute for Health and Care Excellence. Semaglutide for reducing major adverse cardiovascular events in people with cardiovascular disease and overweight or obesity, TA1152. May 2026. NICE TA1152
  28. Medicines and Healthcare products Regulatory Agency. Borderline products: how to tell if your product is a medicine. MHRA borderline-product guidance
  29. Human Medicines Regulations 2012, Regulation 279. UK medicinal-product advertising restriction
  30. World Anti-Doping Agency. 2026 Prohibited List. WADA Prohibited List
  31. International Council for Harmonisation. ICH Q2(R2): Validation of Analytical Procedures. ICH analytical guideline
  32. UK Accreditation Service. Laboratory accreditation and ISO/IEC 17025. UKAS laboratory guidance

Educational, Medical and Research Disclaimer

This article is provided solely for general scientific, analytical, medical and regulatory education. It does not constitute personalised medical advice, diabetes treatment, obesity treatment, cardiovascular treatment, prescribing advice, nutritional advice, pharmaceutical validation or legal advice.

It does not describe or endorse obtaining, preparing, reconstituting, dosing, injecting, escalating, switching, combining, sharing or personally experimenting with native GLP-1, semaglutide, liraglutide, dulaglutide, tirzepatide or another receptor agonist.

Authorised GLP-1 medicines should be used only for their product-specific indications following assessment and prescribing by an appropriately qualified healthcare professional.

Findings from native-hormone infusion studies, receptor assays, diabetes trials, obesity trials and cardiovascular-outcome trials should not be transferred to unidentified research products, imitation pens or unauthorised formulations.

Products marked “Research Use Only” are not automatically authorised, legally compliant, correctly identified, sterile, endotoxin controlled, pharmaceutically equivalent or suitable for human use.

It’s Me & You Clinic does not supply or administer unlicensed research-market GLP-1 products. Anyone concerned about diabetes, obesity, persistent gastrointestinal symptoms, severe abdominal pain, sudden visual change or adverse effects from a prescribed medicine should seek appropriate medical assessment.

 


Previous     Next
Patient Experiences

Real Patient Transformations at It’s Me and You Clinic

Discover why clients across South West London and Surrey choose It’s Me and You Clinic for their facial aesthetics journey. Located in Siddeley House on Kingston Hall Road, our doctor-led clinic is celebrated for delivering stunning, natural-looking results that enhance your unique beauty rather than altering it. From popular anti-wrinkle injections to advanced dermal fillers, our premium treatments are highly recommended by patients and beauty influencers alike for our precise techniques and exceptional safety standards. Whether you are commuting via Kingston Train Station or parking at the nearby Bentalls Shopping Centre for a day of self-care, our welcoming team is dedicated to providing a transformative experience tailored completely to you.

Diren’s Microneedling Experience

Diren from pilateswithdiren recently visited our doctor led facility for a rejuvenating microneedling treatment and highly recommends her calm, professional experience. Located at Siddeley House near Kingston Train Station and the Bentalls Shopping Centre, our clinic specialises in bespoke skin health for clients across South West London and Surrey.

Mila’s Aesthetics Journey with It’s Me and You Clinic

We love the beautiful, natural looking results beauty blogger Mila from thedopaminediaries achieved at our Kingston upon Thames clinic. Based in Siddeley House near Kingston Train Station and the Bentalls Shopping Centre, our doctor led team delivers premium, tailored facial treatments for clients across South West London and Surrey.

Jessie’s Skin Booster Treatment

Jessie from jessie_foodies_london visited our clinic to experience the advanced Neauvia Hydro Deluxe skin booster treatment for a deep hydration lift. Our doctor led team at Siddeley House near Kingston Train Station and the Bentalls Shopping Centre specialises in these premium micro injections to boost collagen across South West London and Surrey. Jessie loved her quick session, gentle care, and the plumper, glowing results with minimal downtime.

Erika’s Cheek Filler Transformation

Erika from lolsbox1 visited Dr Laura Geige for a bespoke cheek filler treatment to address long standing structural insecurities and restore her facial confidence. Our doctor led team at Siddeley House near Kingston Train Station and the Bentalls Shopping Centre specialises in these advanced contouring procedures for clients across South West London and Surrey. She was absolutely thrilled with her glowing results, noting that the highly recommended treatment left her smiling and feeling incredibly confident.

JOIN OUR PRIVATE SKIN COMMUNITY

Gain exclusive early access to Dr Laura’s busy clinic days, premium anti ageing tips, and bespoke skin transformation insights.

Loose skin treatment at It’s Me and You Clinic in London, Kingston upon Thames and Surrey – skin tightening for face, neck, stomach and arms using HIFU, radiofrequency and non-surgical lifting to treat sagging and ageing skin.

Wait ! Before you go....

⭐ WIN FREE AESTHETIC TREATMENTS ⭐

Have you visited It's Me & You Skin Clinic?

Share your experience and you'll be entered into our exclusive prize draw for the chance to win complimentary aesthetic treatments, premium skincare products, and clinic vouchers.

✨ Thank you for supporting our doctor led skin clinic in Kingston Upon Thames. Your feedback helps future patients and allows us to continue providing exceptional care across Surrey and London.

Prize draw terms and conditions apply.