Skip to content
AS FEATURED IN Daily Mail · Independent · Metro · The Sun · Mirror · Express · Netmums · OK! · Newsweek
AS FEATURED IN Daily Mail · Independent · Metro · The Sun · Mirror · Express · Netmums · OK! · Newsweek
AS FEATURED IN Daily Mail · Independent · Metro · The Sun · Mirror · Express · Netmums · OK! · Newsweek
AS FEATURED IN Daily Mail · Independent · Metro · The Sun · Mirror · Express · Netmums · OK! · Newsweek
AS FEATURED IN Daily Mail · Independent · Metro · The Sun · Mirror · Express · Netmums · OK! · Newsweek
AS FEATURED IN Daily Mail · Independent · Metro · The Sun · Mirror · Express · Netmums · OK! · Newsweek

Cagrilintide Peptide UK: Amylin Evidence in the Peptides UK Market

  • 〡
  • 〡 by My Store Admin
Research Peptides UK

Cagrilintide Peptide UK: Amylin Evidence in the Peptides UK Market

Cagrilintide is an investigational, long-acting and lipidated analogue of human amylin. It contains 37 amino-acid residues, six substitutions designed partly to reduce fibril formation, an intramolecular disulphide bond, C-terminal amidation and a fatty-acid side chain intended to extend systemic exposure. Clinical development has examined cagrilintide as an independent weight-management candidate and in combination with semaglutide under the name CagriSema. Phase-two and phase-three studies have reported substantial average weight reductions, but cagrilintide has not yet completed the regulatory process needed to become an authorised UK medicine.

Author: It’s Me & You Clinic Editorial Team Published: 22 July 2026 Last reviewed: 22 July 2026 Reading time: Approximately 27 minutes Regulatory position checked: 22 July 2026
Research and medical notice: This article discusses cagrilintide chemistry, amylin biology, clinical trials, safety, analytical testing and regulation. It does not provide sourcing, preparation, reconstitution, injection, dosing, titration, treatment-cycle, combination or self-experimentation instructions. It’s Me & You Clinic does not supply, prescribe, recommend or administer research-market cagrilintide or CagriSema.
Development status: Cagrilintide is being studied in the phase-three RENEW programme as a monotherapy. CagriSema, its fixed-dose combination with semaglutide, completed pivotal REDEFINE studies and was submitted by Novo Nordisk to the US FDA in December 2025. Submission or paediatric-development planning does not constitute regulatory approval.
UK position: MHRA records include paediatric investigation plans for cagrilintide and cagrilintide with semaglutide, but no authorised UK product name is listed. No current UK marketing authorisation for cagrilintide or CagriSema was identified in the official sources reviewed.

Direct Answer

Cagrilintide is an investigational 37-amino-acid analogue of human amylin, also known as islet amyloid polypeptide.

It preserves the characteristic Cys2-to-Cys7 disulphide bond and amidated C-terminus found in amylin while incorporating six amino-acid substitutions. A long dicarboxylic fatty-acid group is attached to the side chain of the first lysine through a gamma-glutamyl linker.

These modifications reduce the molecule’s tendency to form amyloid-like fibrils and promote reversible binding to albumin, which slows clearance and supports prolonged experimental exposure.

Cagrilintide activates all three recognised amylin-receptor subtypes and the calcitonin receptor. It is therefore more accurately described as a non-selective amylin and calcitonin-family receptor agonist than as a completely selective amylin mimetic.

The primary clinical-development objective is weight management. Amylin pathways contribute to meal termination, satiation, appetite regulation, food-reward processing and gastric or glucagon responses.

In REDEFINE 1, cagrilintide monotherapy produced an estimated 11.8% mean weight reduction at 68 weeks among participants assumed to remain on treatment, compared with 2.3% for placebo.

CagriSema produced a greater estimated reduction of 22.7% under the same trial-product analysis. The intention-to-treat-style treatment-policy estimate was 20.4%, compared with 3.0% for placebo.

These outcomes concern a defined investigational medicine used within controlled trials. They do not establish the identity, safety or effectiveness of online research vials.

Cagrilintide Peptide Key Points

The central chemical, clinical and regulatory facts for readers assessing cagrilintide in the Peptides UK market.

Compound type Lipidated amylin analogue
Peptide length Thirty-seven amino acids
Structural substitutions Six residues
Disulphide bond Cys2 to Cys7
Primary receptor family Amylin and calcitonin receptors
Reported half-life Approximately 159 to 195 hours
Development stage Phase three
UK authorisation None identified

What Is Cagrilintide Peptide?

Cagrilintide is an engineered lipopeptide based on the 37-amino-acid pancreatic hormone amylin.

Human amylin is produced primarily by pancreatic beta cells and released alongside insulin after food intake.

Cagrilintide retains the general amylin framework while replacing six residues to alter stability, solubility, receptor behaviour and aggregation tendency.

Its peptide chain is also attached to a long fatty-acid-derived moiety. This makes it a lipidated peptide rather than an unmodified short hormone.

Earlier development codes include AM833 and NN0174-0833. Novo Nordisk’s current phase-three pipeline also identifies its cagrilintide monotherapy programme as NN9833.

The molecule is being developed independently and as one component of CagriSema, which combines cagrilintide with the GLP-1 receptor agonist semaglutide.

Plain-English explanation: cagrilintide is a redesigned form of a natural fullness-related pancreatic hormone. Scientists changed several amino acids and attached a fatty side chain so the experimental medicine could remain active for much longer.

Cagrilintide Names and Terminology

Product-development names and combination names should not be treated as interchangeable.

Name Meaning Important Distinction
Cagrilintide WHO international non-proprietary name The independent long-acting amylin analogue
AM833 Early development code Used in early pharmacology publications
NN0174-0833 Novo Nordisk development identifier Appears in earlier clinical-development material
NN9833 Current monotherapy programme identifier Listed in the RENEW phase-three programme
CagriSema Cagrilintide combined with semaglutide Contains two active peptide-based agents
Amylin Natural human 37-residue hormone Not identical to cagrilintide
Pramlintide Shorter-acting approved amylin analogue in certain jurisdictions Different substitutions and pharmacokinetics

Cagrilintide is not CagriSema

Cagrilintide refers to the amylin analogue alone. CagriSema contains cagrilintide and semaglutide, so effectiveness and adverse-event data from the combination cannot be assigned entirely to cagrilintide.

What Does Natural Amylin Do?

Amylin contributes to short-term meal regulation and metabolic signalling after food intake.

Amylin is stored with insulin in secretory granules within pancreatic beta cells.

It is released after meals in response to nutrient exposure and rising blood glucose.

The hormone communicates with brain regions involved in satiation, meal termination, nausea, food reward and energy balance.

Important regions include the area postrema and nucleus of the solitary tract within the hindbrain, together with hypothalamic and reward-related neural networks.

Native amylin can slow gastric emptying, reduce post-meal glucagon secretion and help limit meal size.

In type 1 diabetes, beta-cell destruction produces deficiency of both insulin and amylin.

In type 2 diabetes, amylin production and action can become abnormal alongside beta-cell dysfunction and insulin resistance.

Amylin is not merely an appetite suppressant

It participates in an integrated system involving pancreatic secretion, gastric movement, glucagon, brainstem signalling, food reward and interactions with other metabolic hormones.

Cagrilintide Molecular and Scientific Profile

Correct identity requires confirmation of the peptide sequence, lipid side chain, disulphide bond and C-terminal amide.

Molecular identity

Acylated Human-Amylin Analogue

A 37-residue peptide containing six substitutions and one lipidated side chain.

The molecule contains an intramolecular Cys2-to-Cys7 disulphide bond.

Pharmacological function

Amylin and Calcitonin Receptor Agonist

Cagrilintide activates the three recognised amylin-receptor subtypes and the calcitonin receptor.

Its weight-related effects are linked mainly to central amylin-family signalling.

International name Cagrilintide
Historical development code AM833 or NN0174-0833
Peptide length Thirty-seven amino-acid residues
Amino-acid substitutions N14E, V17R, A25P, S28P, S29P and Y37P
Disulphide bond Cys2 to Cys7
C-terminus Amidated
Lipid attachment Lys1 side chain through a gamma-glutamyl linker
Molecular formula C194H312N54O59S2
Approximate molecular weight Approximately 4,409.1 g/mol
Reported human half-life Approximately 159 to 195 hours in an early combination trial
Clinical category Investigational weight-management medicine
UK marketing authorisation None identified

Cagrilintide Amino-Acid Sequence

The main peptide chain contains 37 residues and remains amidated at its final proline.

Lys Cys Asn Thr Ala Thr Cys Ala Thr Gln Arg Leu Ala Glu Phe Leu Arg His Ser Ser Asn Asn Phe Gly Pro Ile Leu Pro Pro Thr Asn Val Gly Ser Asn Thr Pro-NH₂
KCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP-NH₂

The cysteines at positions two and seven are connected through a disulphide bond.

The lysine at position one carries the lipidated linker on its side-chain amino group.

The sequence alone does not represent the complete medicine because it omits the covalently attached gamma-glutamyl and dicarboxylic-fatty-acid structure.

An unlipidated peptide chain is not cagrilintide

A product containing only the 37-residue backbone without the correct Lys1-linked fatty side chain would have different mass, albumin binding, clearance and pharmacological exposure.

How Cagrilintide Differs From Human Amylin

Six substitutions alter charge, receptor behaviour, stability and susceptibility to fibril formation.

Position Human Amylin Cagrilintide Scientific Relevance
14 Asparagine Glutamic acid Introduces an acidic residue and alters molecular interactions
17 Valine Arginine Introduces a positively charged residue
25 Alanine Proline Disrupts beta-sheet-prone conformations
28 Serine Proline Contributes to reduced fibril formation
29 Serine Proline Further changes the aggregation-prone region
37 Tyrosine Proline Changes the C-terminal receptor-interaction region

Proline residues restrict the peptide backbone and can interfere with the extended beta-sheet structures involved in amyloid formation.

Replacing multiple residues does not simply create a more stable copy of amylin. It creates a new pharmacological substance with its own receptor profile and safety requirements.

Why Does Cagrilintide Have a Fatty-Acid Side Chain?

Lipidation promotes albumin association and slows the molecule’s removal from circulation.

The first lysine carries a gamma-glutamyl linker connected to a 19-carboxynonadecanoyl group.

This is a long dicarboxylic fatty-acid-derived structure.

Fatty-acid attachment allows reversible non-covalent association with circulating albumin.

Albumin binding reduces immediate kidney filtration and can protect part of the molecule from rapid enzymatic degradation.

An early human trial reported a cagrilintide half-life of approximately 159 to 195 hours, which is compatible with prolonged experimental exposure.

The measured peak concentration occurred substantially later than it would for unmodified amylin.

Long acting does not mean permanently active

Exposure still varies with absorption, albumin concentration, kidney and liver function, antibodies, formulation, dose escalation and individual physiology.

Cagrilintide, Amyloid Formation and Aggregation

The molecule was engineered partly to address a central limitation of native human amylin.

Human amylin can form insoluble amyloid fibrils, particularly within the pancreatic islets of people with type 2 diabetes.

Native amylin is therefore unsuitable as a straightforward injectable medicine.

Proline substitutions disrupt regions that readily adopt fibril-forming beta-sheet structures.

Reduced intrinsic amyloid tendency does not eliminate every pharmaceutical aggregation risk.

Lipidated peptides can form dimers, oligomers, particles or surface-associated aggregates during synthesis, purification, freeze drying, storage and temperature excursions.

Aggregates can affect active concentration, absorption and immunogenicity.

Sequence design does not replace finished-product testing

A molecule engineered to resist amyloid formation can still aggregate because of oxidation, incorrect disulphide pairing, high concentration, incompatible excipients or poor storage.

Which Receptors Does Cagrilintide Activate?

Amylin receptors are formed when a calcitonin receptor associates with receptor-activity-modifying proteins.

The calcitonin receptor is a class-B G-protein-coupled receptor.

Association with receptor-activity-modifying protein one creates the AMY1 receptor.

Association with receptor-activity-modifying protein two creates the AMY2 receptor.

Association with receptor-activity-modifying protein three creates the AMY3 receptor.

The receptor’s pharmacology changes according to the associated modifying protein.

Cagrilintide has been described as a non-selective agonist at human amylin receptors and the uncomplexed calcitonin receptor.

This differentiates it from newer candidates being designed for stronger selectivity towards one amylin-receptor subtype.

Key distinction: cagrilintide is often called an amylin analogue because that is its therapeutic rationale, but its experimentally measured receptor activity is not restricted to one amylin receptor.

How Is Cagrilintide Proposed to Affect Body Weight?

The main effect is believed to involve reduced energy intake through central satiation and appetite pathways.

Meal Termination

Amylin-receptor signalling in the hindbrain contributes to the perception that sufficient food has been consumed.

This can reduce meal size before physical stomach capacity is reached.

Appetite Between Meals

Signals from the area postrema and nucleus of the solitary tract communicate with hypothalamic networks that influence hunger and energy balance.

Food Reward

Amylin pathways also interact with neural systems involved in food motivation and reward.

Reduced reward-driven eating is not equivalent to elimination of emotional, social or environmental eating behaviour.

Energy Expenditure

Most clinical weight reduction appears to arise from lower energy intake.

No evidence establishes that cagrilintide produces substantial independent fat burning or overrides the biological adaptation to weight loss.

Cagrilintide activates amylin-family receptors
Hindbrain and hypothalamic signals change
Satiation and food-reward responses increase
Average energy intake may fall
Body weight may decline over sustained treatment

Appetite reduction is not a complete obesity treatment

Obesity care may also require nutritional support, physical activity, sleep assessment, psychological care, management of medicines and treatment of metabolic or mechanical complications.

Gastric Emptying, Glucagon and Blood-Glucose Research

Natural amylin influences gastric and pancreatic responses, but cagrilintide’s full human metabolic profile remains under development.

Native amylin and the approved analogue pramlintide slow gastric emptying and suppress inappropriate post-meal glucagon secretion.

These effects can reduce the rate at which glucose appears in the circulation after eating.

Cagrilintide’s prolonged receptor activity may not reproduce the exact time course of short-acting amylin.

The phase-three combination studies show improvements in glycated haemoglobin among participants with type 2 diabetes, but semaglutide is a major contributor to glucose-dependent insulin and glucagon effects.

Combination findings therefore cannot determine the independent glucose-lowering contribution of cagrilintide without direct monotherapy comparison.

Is Cagrilintide a GLP-1 Peptide?

No. It is an amylin analogue with a separate sequence and receptor system.

Semaglutide, liraglutide and related medicines activate the GLP-1 receptor.

Cagrilintide activates amylin and calcitonin-family receptors.

Both systems can reduce appetite and food intake, but they do so through overlapping and partly distinct neural populations.

The combination strategy aims to engage complementary pathways rather than increase the action of one receptor alone.

Cagrilintide should therefore not be described as another form of semaglutide, Ozempic or Wegovy.

Feature Cagrilintide Semaglutide
Hormone model Amylin GLP-1
Main receptors Amylin receptors and calcitonin receptor GLP-1 receptor
Peptide length 37 residues 31-residue GLP-1 analogue structure
Clinical status Investigational Authorised in specific products and indications
Combination name CagriSema when formulated together

Cagrilintide Research in the Peptides UK Market

Commercial demand has developed before completion of regulatory review or establishment of an authorised supply chain.

Cagrilintide appears in Peptides UK listings as a lyophilised vial, research standard, premixed blend or combination with semaglutide and other metabolic peptides.

Common descriptions promise appetite elimination, faster weight loss, reduced cravings, overcoming a GLP-1 plateau, improved fat loss and fewer adverse effects than established medicines.

These claims frequently omit that published clinical studies used Novo Nordisk’s defined investigational product under trial monitoring.

Cagrilintide is more structurally complex than many short research peptides because identity depends on a 37-residue sequence, disulphide pairing, amidation and a precisely attached lipid side chain.

A supplier producing only an unmodified peptide backbone would not be supplying the clinical-development molecule.

Grey-market combinations create additional uncertainty because each active component and its quantity must be established independently.

A trial result does not authenticate a commercial vial

Clinical efficacy cannot be transferred to products lacking validated identity, potency, sterility, endotoxin control, stability and equivalence to the studied formulation.

Early Human Cagrilintide Research

Initial trials focused on safety, tolerability, pharmacokinetics and short-term changes in food intake or body weight.

Early development used escalating exposure to determine whether the prolonged amylin analogue could be administered repeatedly.

Researchers monitored gastrointestinal symptoms, vital signs, laboratory measurements, antibodies and pharmacokinetic concentrations.

These studies established a prolonged half-life and supported further weekly-treatment research.

Early trials were not designed to determine long-term cardiovascular outcomes, rare adverse effects or durability over several years.

Small phase-one cohorts can miss events that occur infrequently or only in people with complex medical conditions.

The Phase-Two Cagrilintide Monotherapy Trial

A 26-week study demonstrated dose-related weight reduction in adults without type 2 diabetes.

The multicentre trial enrolled adults with obesity or overweight and at least one weight-related condition.

Participants were assigned to several weekly cagrilintide groups, placebo or daily liraglutide as an active comparator.

Treatment was combined with lifestyle intervention and included a dose-escalation period.

Weight reduction increased across the cagrilintide groups.

At the upper studied exposure, estimated mean weight reduction reached approximately 10.8% after 26 weeks, compared with approximately 3.0% for placebo.

Cagrilintide at the highest investigated exposure produced greater average weight loss than liraglutide within the study’s analysis.

Gastrointestinal symptoms were the most frequent treatment-related issue and were generally reported as mild to moderate.

Phase two was dose finding, not regulatory confirmation

The study supported later development but did not establish long-term safety, cardiovascular benefit, routine prescribing or grey-market product equivalence.

Cagrilintide Monotherapy in REDEFINE 1

The cagrilintide arm provided phase-three evidence for the independent amylin component.

REDEFINE 1 enrolled 3,417 adults with obesity or overweight and a weight-related condition who did not have diabetes.

Participants were allocated to CagriSema, semaglutide, cagrilintide or placebo alongside lifestyle intervention.

The cagrilintide monotherapy group contained 302 participants.

Under the trial-product estimand, which estimated the effect if participants adhered to treatment, cagrilintide produced 11.8% mean weight reduction at 68 weeks.

Placebo produced 2.3% mean reduction under the same analysis.

More than 30% of cagrilintide participants reached at least 15% weight reduction in Novo Nordisk’s reported subanalysis.

Gastrointestinal adverse events occurred in approximately 54% of cagrilintide participants and 40% of placebo participants.

Permanent discontinuation because of gastrointestinal adverse events occurred in approximately 1.3% of the cagrilintide group.

Interpretation: cagrilintide demonstrated an independent weight-management effect, although average reduction was lower than semaglutide and substantially lower than the two-drug CagriSema combination within the same study.

What Is CagriSema?

CagriSema is a fixed-dose investigational combination of cagrilintide and semaglutide.

Cagrilintide supplies prolonged amylin and calcitonin-family receptor activity.

Semaglutide supplies prolonged GLP-1 receptor activity.

The combination aims to produce complementary effects on satiation, hunger, food reward and glucose control.

CagriSema is not one hybrid peptide. It contains two separate active molecules within one development programme and proposed pharmaceutical presentation.

Each component therefore requires its own identity, assay and impurity controls.

A commercial blend cannot be authenticated through a single chromatographic purity value.

Early Cagrilintide and Semaglutide Combination Research

A phase-one-b trial evaluated whether the two long-acting peptides could be administered together.

The trial included 95 exposed participants with overweight or obesity who were otherwise considered healthy.

Multiple cagrilintide exposure groups were studied alongside semaglutide.

Cagrilintide exposure increased approximately in proportion to the administered amount and did not materially alter semaglutide exposure or elimination.

The reported cagrilintide half-life ranged from 159 to 195 hours.

Gastrointestinal disorders accounted for 37% of all recorded adverse events, although most events were mild to moderate.

A substantial mean weight reduction was observed during the short trial, providing support for larger studies.

A small early trial cannot define long-term safety

Fewer than one hundred exposed participants cannot establish the frequency of uncommon pancreatic, gallbladder, psychiatric, allergic, cardiovascular or neoplastic events.

The REDEFINE 1 CagriSema Trial

This pivotal study compared the combination with placebo and with each independent component.

REDEFINE 1 was a 68-week, randomised, double-blind, placebo-controlled and active-controlled phase-three trial.

It enrolled 3,417 adults with obesity or overweight and at least one weight-related complication, without diabetes.

Under the treatment-policy estimand, which includes the effects of discontinuation and treatment changes, mean weight reduction was 20.4% with CagriSema and 3.0% with placebo.

Under the trial-product estimand, mean reduction was 22.7% with CagriSema, 16.1% with semaglutide, 11.8% with cagrilintide and 2.3% with placebo.

Under the treatment-policy analysis, 53.6% of CagriSema participants reached at least 20% weight reduction.

Approximately 34.7% reached at least 25%, while 19.3% reached at least 30%.

These percentages were estimated population outcomes rather than promises for an individual.

Adverse Events

Any adverse event was reported by 92.3% of CagriSema participants and 82.3% of placebo participants.

Gastrointestinal events occurred in 79.6% of the CagriSema group, 73.8% with semaglutide, 54.0% with cagrilintide and 39.9% with placebo.

Permanent discontinuation because of any adverse event occurred in 5.9% of CagriSema participants.

Gastrointestinal events caused permanent discontinuation in 3.6% of the CagriSema group.

Gallbladder-related disorders, fatigue, dizziness, alopecia and injection-site reactions occurred more frequently with CagriSema than with placebo.

Four pancreatitis cases occurred in the CagriSema group and one in the semaglutide group.

Combination results cannot be assigned to cagrilintide alone

CagriSema’s effectiveness and adverse-event profile arise from two active molecules, their interaction and the trial’s escalation and maintenance programme.

The REDEFINE 2 Trial in Type 2 Diabetes

Weight reduction is generally lower in diabetes populations than in comparable trials without diabetes.

REDEFINE 2 enrolled 1,206 adults with overweight or obesity and type 2 diabetes.

Participants received CagriSema or placebo alongside lifestyle intervention.

Under the treatment-policy estimand, mean weight reduction at 68 weeks was 13.7% with CagriSema and 3.4% with placebo.

Under the trial-product estimand, the corresponding results were 15.7% and 3.1%.

A glycated-haemoglobin level of 6.5% or below was achieved by 73.5% of the CagriSema group and 15.9% of the placebo group.

Gastrointestinal adverse events affected 72.5% of CagriSema participants and 34.4% of placebo participants.

Permanent discontinuation because of an adverse event occurred in 8.4% of CagriSema participants and 3.0% of placebo participants.

Three pancreatitis events occurred in the combination group.

The trial did not compare CagriSema directly with cagrilintide or semaglutide monotherapy.

CagriSema and Type 2 Diabetes Research in 2026

The REIMAGINE programme evaluates glucose control and weight outcomes across different diabetes-treatment settings.

Novo Nordisk announced headline REIMAGINE 2 results in February 2026.

The 68-week study enrolled 2,728 adults whose diabetes was inadequately controlled by metformin with or without an SGLT2 inhibitor.

Under the efficacy estimand, CagriSema produced a 1.91-percentage-point reduction in glycated haemoglobin, compared with 1.76 points for semaglutide.

Mean weight reduction was 14.2% with CagriSema and 10.2% with semaglutide.

Novo Nordisk described the common adverse events as gastrointestinal and predominantly mild to moderate.

These were company-reported headline data at the date reviewed. Detailed peer-reviewed results were expected to be presented during 2026.

Headline results require full publication

A press announcement cannot show every subgroup, missing-data assumption, adverse-event category, laboratory outcome or protocol deviation needed for comprehensive independent assessment.

Current Cagrilintide Development in 2026

Cagrilintide monotherapy and CagriSema now follow separate but related development pathways.

RENEW Monotherapy Programme

Cagrilintide entered the phase-three RENEW programme after its independent REDEFINE 1 results.

RENEW 1 is evaluating cagrilintide in adults with overweight or obesity without diabetes.

RENEW 2 is evaluating cagrilintide in people with overweight or obesity and type 2 diabetes.

These trials are intended to provide more direct evidence about cagrilintide without semaglutide.

CagriSema Regulatory Submission

Novo Nordisk reported submitting CagriSema to the US FDA for weight management in December 2025.

A submitted application remains subject to scientific, manufacturing, clinical and labelling review.

No FDA approval for CagriSema was identified as of 22 July 2026.

Cardiovascular Outcomes

REDEFINE 3 is an event-driven cardiovascular-outcomes trial involving approximately 7,000 adults with established cardiovascular disease and overweight or obesity.

The study is intended to assess cardiovascular safety and whether CagriSema affects major cardiovascular events.

Weight reduction and lower risk-factor measurements cannot substitute for completed cardiovascular-outcome evidence.

Paediatric Research

MHRA and EMA paediatric-development records exist for cagrilintide and its combination with semaglutide.

Paediatric investigation planning is a development requirement and does not establish that the medicine is suitable or authorised for children.

Cagrilintide Evidence at a Glance

The molecule has substantial clinical evidence for an investigational peptide, but important approval and safety questions remain.

Research Question Evidence Type Current Finding Main Limitation
Is cagrilintide a defined peptide? WHO structural definition Yes, a lipidated 37-residue amylin analogue Commercial products require batch confirmation
Does it contain six substitutions? WHO sequence definition Yes Labels do not prove the supplied sequence
Does it activate amylin receptors? Receptor pharmacology Yes It also activates the calcitonin receptor
Is it long acting? Human pharmacokinetic research Half-life of approximately 159 to 195 hours reported Formulation and exposure specific
Does monotherapy reduce body weight? Phase-two and REDEFINE 1 evidence Clinically meaningful average reduction reported Long-term outcome evidence remains incomplete
What did phase two show? 26-week randomised trial Up to approximately 10.8% mean reduction Dose-finding duration and sponsor-funded study
What did REDEFINE 1 monotherapy show? Phase-three active-control arm 11.8% under the trial-product estimand Smaller monotherapy arm than the combination arm
Does CagriSema outperform each component? REDEFINE 1 Greater average weight reduction reported Two-drug adverse effects also increase
What was the REDEFINE 1 treatment-policy result? Phase-three trial 20.4% versus 3.0% with placebo Population average rather than individual prediction
Does CagriSema work in type 2 diabetes? REDEFINE 2 and REIMAGINE programme Weight and glycaemic improvements reported Semaglutide contribution cannot be separated completely
Are gastrointestinal effects common? Multiple clinical trials Yes Frequency depends on combination, escalation and population
Does cagrilintide preserve muscle? Limited body-composition analyses Not established as a muscle-preserving treatment Lean soft-tissue loss occurs during substantial weight loss
Does it improve cardiovascular outcomes? Outcome trial in progress Not yet established Risk-factor changes are not event outcomes
Is cagrilintide authorised in the UK? Official regulatory-source review No marketing authorisation identified Development plans are not approvals
Is CagriSema FDA approved? Company and trial-registry review No approval identified as of 22 July 2026 Application remains subject to regulatory review

Important Cagrilintide Research Limitations

Large weight-management trials answer important questions without resolving every long-term clinical issue.

  • Cagrilintide remains an investigational medicine.
  • No current UK marketing authorisation was identified.
  • No FDA approval was identified as of the review date.
  • The independent RENEW phase-three programme remains in progress.
  • Long-term cardiovascular-outcome evidence is not yet complete.
  • Clinical trials were funded by the manufacturer.
  • Several publications include company-employed investigators.
  • Trial participants were selected using eligibility criteria.
  • Results may not generalise to every medical condition.
  • Average results do not predict individual response.
  • Some participants did not reach the highest planned exposure.
  • Flexible modification complicates simple dose comparisons.
  • Trial-product and treatment-policy estimands answer different questions.
  • The larger 22.7% result assumes continued treatment adherence.
  • The treatment-policy REDEFINE 1 estimate was lower at 20.4%.
  • CagriSema data cannot define cagrilintide’s independent effects fully.
  • Semaglutide contributes to efficacy and adverse events.
  • Type 2 diabetes populations show different responses.
  • Gastrointestinal events are common.
  • Long-term nutritional consequences require further study.
  • Lean soft-tissue loss can accompany substantial weight loss.
  • Weight regain after discontinuation is not fully characterised.
  • Rare pancreatic events require larger cumulative exposure.
  • Gallbladder risk may be influenced by rapid weight reduction.
  • Long-term pregnancy and reproductive safety is not established.
  • Paediatric efficacy and safety remain under investigation.
  • People with severe gastrointestinal disease may be underrepresented.
  • Grey-market products may not contain cagrilintide.
  • An unlipidated backbone is not authentic cagrilintide.
  • Incorrect lipid attachment can alter pharmacokinetics.
  • Incorrect disulphide pairing can alter receptor activity.
  • A standard HPLC result cannot prove lipidated-peptide identity.
  • Research products may lack endotoxin and sterile controls.

Cagrilintide Safety and Adverse-Event Evidence

The available profile comes from clinical development rather than a completed post-authorisation pharmacovigilance system.

Most recorded adverse events have involved the gastrointestinal system.

Injection-site reactions, fatigue, dizziness and allergic-type events have also been reported.

The combination with semaglutide produces more gastrointestinal events than cagrilintide monotherapy.

Serious adverse events occurred in all REDEFINE 1 groups and were not confined to one organ system.

A clinical trial is not necessarily large enough to identify very rare adverse effects or risks emerging after several years.

No authorised prescribing information currently defines contraindications, warning language, interactions or monitoring requirements specifically for UK cagrilintide use.

Investigational tolerability is not established consumer safety

Trial participants received manufactured study medicine, escalation rules, scheduled assessments and adverse-event follow-up. Grey-market use lacks these controls.

Gastrointestinal Effects

Nausea, constipation, diarrhoea and vomiting are the most consistently reported cagrilintide-related symptoms.

Cagrilintide Monotherapy

In the REDEFINE 1 cagrilintide group, approximately 54% reported a gastrointestinal adverse event.

Nausea affected approximately 23.8%, constipation 20.5%, diarrhoea 15.2% and vomiting 7.0%.

These events were more frequent than with placebo.

CagriSema

In REDEFINE 1, approximately 79.6% of CagriSema participants reported a gastrointestinal event.

Nausea affected approximately 55.0%, constipation 30.7%, vomiting 26.1% and diarrhoea 24.5%.

Nausea, vomiting and diarrhoea were most prevalent during escalation and generally became less common later.

Constipation remained more persistent across the treatment period.

Clinical Significance

Repeated vomiting or diarrhoea can cause dehydration, electrolyte disturbance and kidney injury.

Persistent appetite suppression can also reduce protein, vitamin, mineral and fluid intake.

Delayed gastric movement may be relevant before anaesthesia or procedures requiring fasting, although specific cagrilintide guidance has not yet been authorised.

Gallbladder, Pancreatic and Abdominal Risks

Observed events are uncommon but clinically important.

Gallbladder Disorders

Gallbladder-related disorders occurred in 4.1% of the CagriSema group, 3.0% with semaglutide, 2.3% with cagrilintide and 1.0% with placebo in REDEFINE 1.

Rapid or substantial weight reduction independently increases the likelihood of gallstones.

This makes it difficult to assign every event solely to direct receptor pharmacology.

Pancreatitis

Pancreatitis was reported in four CagriSema participants and one semaglutide participant in REDEFINE 1.

Three events were reported with CagriSema in REDEFINE 2.

These small numbers cannot define comparative risk reliably.

Severe persistent abdominal pain, particularly with vomiting or pain radiating to the back, requires urgent medical assessment.

Low event numbers do not prove absence of risk

Rare adverse effects require large cumulative exposure, careful adjudication and post-authorisation surveillance before their frequency can be estimated confidently.

Cagrilintide and Hypoglycaemia

Risk depends on diabetes status and accompanying glucose-lowering medicines.

Amylin analogues can suppress post-meal glucagon and slow nutrient delivery from the stomach.

These effects may alter the timing of glucose appearance after food.

Cagrilintide alone is not expected to stimulate insulin secretion directly in the same way as a GLP-1 receptor agonist.

CagriSema includes semaglutide, which enhances glucose-dependent insulin secretion.

Hypoglycaemia risk can increase when appetite and food intake fall in someone continuing insulin or a medicine that stimulates insulin independently of glucose.

The low overall incidence recorded in controlled trials does not establish safety for unmonitored combinations or people with unpredictable food intake.

Research products should not be added to diabetes treatment independently

Changes in food intake, gastric emptying and glucose-lowering treatment can create delayed or severe hypoglycaemia without appropriate clinical adjustment and monitoring.

Cagrilintide, Fat Loss and Lean Mass

Substantial weight reduction normally includes loss of both fat mass and lean soft tissue.

A supportive REDEFINE 1 body-composition analysis assessed a subgroup using dual-energy X-ray absorptiometry.

Novo Nordisk reported that approximately two-thirds of total CagriSema weight loss represented fat mass and one-third represented lean soft-tissue mass.

Lean soft tissue is not identical to skeletal muscle because it also includes water, organs and other non-fat tissues.

The analysis does not establish that cagrilintide preserves muscle more effectively than every other weight-management intervention.

Adequate protein intake, resistance exercise, treatment of deficiencies and assessment of frailty remain important during substantial weight loss.

Excessive appetite suppression can make nutritional targets difficult to achieve.

Weight loss and healthy body composition are not identical outcomes

A lower scale reading can coexist with reduced strength, low protein intake or loss of functional tissue, particularly in older or medically vulnerable people.

Pregnancy, Fertility and Reproductive Safety

No authorised pregnancy guidance currently exists for cagrilintide in the UK.

Weight-management trials exclude people who are pregnant, breastfeeding or planning pregnancy during the study.

Intentional pharmacological weight loss is generally inappropriate during pregnancy.

Cagrilintide’s prolonged half-life means exposure would not end immediately after discontinuation.

Adequate human evidence concerning embryo-fetal development, breastfeeding transfer and long-term child outcomes has not been established.

Improved ovulation can occur after substantial weight reduction in some people, which may increase the possibility of pregnancy even without a direct fertility-drug effect.

Absence of pregnancy data is not reassurance

It reflects systematic exclusion from trials and the need for dedicated reproductive toxicology and regulatory assessment.

Long-Term Cagrilintide Uncertainties

Obesity is a chronic condition, making durability and multi-year safety central questions.

Weight Maintenance

It is not yet known how much weight is regained after long-term cagrilintide discontinuation.

Experience with other appetite-regulating medicines suggests that biological pressures favouring weight regain can return when treatment ends.

Cardiovascular Outcomes

Lower blood pressure, waist circumference and inflammatory markers are encouraging risk-factor changes.

They do not prove fewer heart attacks, strokes or cardiovascular deaths.

REDEFINE 3 is intended to answer this outcome question for CagriSema.

Nutritional and Functional Outcomes

Long-term monitoring must consider muscle function, bone health, micronutrient intake and quality of life rather than body weight alone.

Rare Adverse Effects

Uncommon immune, pancreatic, gallbladder, psychiatric or neoplastic signals may require exposure across much larger populations.

Phase-three completion is not the end of safety assessment

Post-authorisation pharmacovigilance, real-world comparative research and longer outcome trials normally continue after a medicine reaches the market.

Research-Market Cagrilintide Quality Risks

Lipidated, disulphide-containing peptides require more extensive control than an ordinary short linear peptide.

  • Incorrect peptide entirely
  • Unlipidated 37-residue backbone
  • Incomplete amino-acid sequence
  • Incorrect N14E substitution
  • Incorrect V17R substitution
  • Missing proline substitutions
  • Incorrect C-terminal residue
  • Missing C-terminal amidation
  • Reduced cysteine residues
  • Incorrect Cys2-to-Cys7 disulphide pairing
  • Fatty side chain attached at the wrong position
  • Incomplete gamma-glutamyl linker
  • Incorrect fatty-acid chain length
  • Free unbound lipid impurity
  • Deletion-sequence impurities
  • Epimerised amino acids
  • Oxidised methionine-free but other oxidative products
  • Deamidation of asparagine or glutamine residues
  • Peptide aggregates
  • Lipid-related micelles or particles
  • Incorrect net peptide quantity
  • Residual synthesis reagents
  • Residual organic solvents
  • Residual trifluoroacetate
  • Unverified endotoxin control
  • Unverified sterile quality
  • Particulate contamination
  • Degradation during transport
  • Incorrect CagriSema component ratio
  • Certificate unrelated to the supplied batch

A blend creates two sets of quality risks

A product labelled CagriSema must establish authentic cagrilintide and authentic semaglutide separately, together with their ratio, compatibility, degradation profile and finished-product quality.

How Cagrilintide Research Material Should Be Analytically Tested

Identity cannot be demonstrated by one retention time or a generic “99% purity” statement.

Intact identity

High-Resolution Mass Spectrometry

The intact mass should support the complete peptide, linker, lipid and disulphide state.

Sequence

Peptide Mapping and Tandem MS

Fragment analysis should confirm all six substitutions and the remaining amylin-derived sequence.

Lipidation

Attachment-Site Confirmation

Testing should establish that the lipidated gamma-glutamyl side chain is connected to Lys1 rather than another amino group.

Fatty side chain

Linker and Chain Characterisation

The correct dicarboxylic-fatty-acid identity and linker composition should be confirmed independently.

Folding

Disulphide-Bond Mapping

Methods should confirm the Cys2-to-Cys7 linkage and quantify reduced or incorrectly linked material.

C-terminus

Amidation Confirmation

Pro37 amide should be distinguished from the corresponding free carboxylic-acid impurity.

Aggregation

Orthogonal Size Analysis

Size-exclusion chromatography, light scattering or analytical ultracentrifugation may be needed to detect higher-molecular-weight species.

Function

Receptor Potency Assays

Validated cell assays should assess activity at relevant amylin receptors and the calcitonin receptor.

What Meaningful Cagrilintide Documentation Should Include

  • Complete cagrilintide identity
  • Full 37-residue sequence
  • Confirmation of all six substitutions
  • Observed intact molecular mass
  • Peptide-map sequence coverage
  • Tandem-MS fragment evidence
  • Confirmation of Lys1 lipidation
  • Gamma-glutamyl-linker identity
  • Fatty-acid-chain identity
  • Free lipid impurity result
  • Cys2-to-Cys7 disulphide map
  • Reduced-thiol result
  • C-terminal amidation result
  • Net cagrilintide assay
  • Chromatographic purity
  • Deletion-sequence profile
  • Deamidation profile
  • Epimerisation assessment where relevant
  • Aggregate and particle analysis
  • Albumin-binding characterisation where relevant
  • Amylin-receptor potency
  • Calcitonin-receptor potency
  • Residual-solvent results
  • Residual synthesis-reagent results
  • Counterion result
  • Water-content result
  • Bacterial-endotoxin result
  • Sterility result for finished injectable medicine
  • Visible and subvisible particle results
  • Batch-specific stability evidence
  • Testing-laboratory identity
  • Analytical methods and acceptance criteria
  • A statement identifying tests not performed

Why “99% HPLC” Is Not Enough

HPLC area purity does not prove that the main peak contains the complete lipidated cagrilintide molecule.

An unlipidated precursor, incorrectly attached lipid, unamidated variant or disulphide error may remain chemically similar.

Conventional reverse-phase analysis may also underrepresent aggregates, free lipid, particles, endotoxins and microbiological contamination.

A certificate for raw peptide does not establish the quality of the finished vial or combination product.

Cagrilintide Regulation in the Peptides UK Market

Regulatory information checked on 22 July 2026.

No UK Marketing Authorisation Identified

No current UK marketing authorisation for a medicinal product containing cagrilintide or the CagriSema combination was identified in the official sources reviewed.

Cagrilintide should not be presented as an approved UK treatment for obesity, overweight, type 2 diabetes, appetite control, metabolic disease or another condition.

An FDA submission, phase-three trial or MHRA paediatric investigation plan does not provide permission to prescribe or market an unlicensed product routinely.

MHRA Development Records

The MHRA records a paediatric investigation plan for cagrilintide as an obesity-treatment candidate.

Separate plans exist for cagrilintide with semaglutide in obesity and type 2 diabetes.

The records identify no currently available invented UK medicine name.

Paediatric planning is part of medicine development and should not be confused with a positive benefit-risk decision.

Medicinal-Product Classification

A product presented as reducing obesity, suppressing appetite, treating diabetes or modifying body weight through receptor pharmacology is strongly medicinal in character.

MHRA classification considers intended use, claims, pharmacological action, labels, imagery, testimonials, websites and customer instructions.

“Research Use Only” Wording

A research disclaimer does not determine legal status where surrounding material encourages personal administration or describes treatment outcomes.

Advertising Restrictions

Regulation 279 of the Human Medicines Regulations restricts advertising a medicinal product unless the required authorisation, registration or certificate is in force.

This section provides general regulatory education and does not constitute legal advice.

Cagrilintide and Competitive Sport

Cagrilintide was not identified by name on the reviewed 2026 WADA Prohibited List.

WADA section S0 prohibits pharmacologically active substances that are not addressed elsewhere in the list and do not have current approval by a governmental regulatory health authority for human therapeutic use.

Cagrilintide remained investigational and lacked identified regulatory approval on the review date.

It may therefore fall within S0 as a non-approved substance. This is an application of the published rule rather than a cagrilintide-specific WADA entry.

A combination product can also contain separately prohibited or undeclared ingredients.

Athletes should obtain a current product-specific ruling through UK Anti-Doping, Global DRO or their international federation.

Not named does not mean permitted

WADA’s S0 category exists specifically to cover experimental, designer and non-approved pharmacological substances that may not yet appear individually by name.

Common Cagrilintide Peptide Claims Examined

Accurate interpretation requires separating established trial findings from commercial promises.

The claim

“Cagrilintide is a GLP-1.”

It is an amylin analogue acting at amylin and calcitonin-family receptors.

Semaglutide is the GLP-1 component of CagriSema.

The claim

“Cagrilintide and CagriSema are the same.”

Cagrilintide is one active molecule.

CagriSema combines cagrilintide with semaglutide.

The claim

“It is ordinary human amylin.”

Cagrilintide is based on human amylin.

Six substitutions and a large lipidated side chain make it a distinct pharmacological substance.

The claim

“Any 37-residue cagrilintide sequence will work.”

The peptide backbone is only part of the molecule.

Correct lipidation, disulphide pairing and C-terminal amidation are also essential.

The claim

“It causes 22.7% weight loss by itself.”

The 22.7% REDEFINE 1 result concerned CagriSema under a trial-product estimand.

Cagrilintide monotherapy produced 11.8% in the corresponding analysis.

The claim

“Everyone loses more than 20%.”

Clinical-trial results are averages across participants.

Individual response varied, and not every participant reached the same threshold.

The claim

“Cagrilintide eliminates hunger completely.”

It can increase satiation and reduce appetite.

No controlled evidence establishes complete hunger elimination or freedom from environmental and emotional eating.

The claim

“It burns fat directly.”

Most weight reduction is attributed to reduced energy intake.

No evidence establishes a large independent thermogenic or direct fat-burning action.

The claim

“It preserves all muscle.”

Substantial weight loss includes both fat and lean soft-tissue reduction.

Cagrilintide is not an established muscle-preserving treatment.

The claim

“It has fewer side effects than GLP-1 medicines.”

Cagrilintide monotherapy produced fewer gastrointestinal events than CagriSema or semaglutide in REDEFINE 1.

This does not establish universal superior tolerability or equivalent effectiveness.

The claim

“It is safe because amylin occurs naturally.”

Native amylin is endogenous.

Cagrilintide is a prolonged, modified receptor agonist with different exposure and additional receptor activity.

The claim

“Phase three means approved.”

Phase three provides pivotal evidence for regulatory assessment.

Approval requires a separate review of clinical benefit, safety, manufacturing and labelling.

The claim

“The FDA submission makes CagriSema legal to prescribe.”

A submitted application is a request for review.

It does not create marketing authorisation before a positive decision.

The claim

“A 99% HPLC certificate proves it is genuine.”

HPLC provides one measure of chromatographic composition.

It does not prove lipid identity, attachment site, disulphide pairing, amidation, potency or sterile quality.

Cagrilintide Compared With Related Metabolic Peptides

Shared weight-management research does not mean identical receptors, chemistry or approval status.

Compound Primary Pharmacology Development or Regulatory Context Important Distinction
Cagrilintide Amylin and calcitonin receptor agonism Phase-three development Long-acting lipidated amylin analogue
Human amylin Endogenous amylin-receptor signalling Natural pancreatic hormone Short lived and prone to fibril formation
Pramlintide Amylin-receptor agonism Authorised in the United States for selected diabetes use Shorter acting and structurally different
Semaglutide GLP-1 receptor agonism Authorised in specific products Forms the second CagriSema component
CagriSema Amylin, calcitonin and GLP-1 receptor activity Submitted to the FDA and under development Two-molecule fixed-dose combination
Tirzepatide GIP and GLP-1 receptor agonism Authorised in specified jurisdictions and indications Does not activate amylin receptors directly
Retatrutide GIP, GLP-1 and glucagon receptor agonism Investigational Triple incretin and glucagon-family agonist
Eloralintide More selective amylin-receptor agonism Investigational Designed for reduced calcitonin-receptor activity
Petrelintide Long-acting amylin analogue Investigational Separate molecule and development programme
Zenagamtide Single-molecule GLP-1 and amylin agonism Phase-three development One unimolecular dual agonist rather than a two-drug mixture

How to Assess Cagrilintide and Peptides UK Evidence Critically

Use this checklist before accepting a molecular, clinical, safety or regulatory claim.

  • Is the substance cagrilintide or CagriSema?
  • Is it distinguished from semaglutide?
  • Is it distinguished from pramlintide?
  • Is the complete 37-residue sequence stated?
  • Are all six substitutions confirmed?
  • Is the Lys1 lipid attachment verified?
  • Is the gamma-glutamyl linker identified?
  • Is the fatty-acid chain confirmed?
  • Is the Cys2-to-Cys7 disulphide bond mapped?
  • Is C-terminal amidation confirmed?
  • Was intact mass measured?
  • Was tandem-MS sequence coverage provided?
  • Were deletion sequences assessed?
  • Were free lipid and partial conjugates assessed?
  • Were aggregates and particles measured?
  • Was receptor potency tested?
  • Was net peptide quantity measured?
  • Was bacterial endotoxin tested?
  • Was finished-product sterility demonstrated?
  • Does the certificate match the supplied batch?
  • Was the study monotherapy or combination therapy?
  • Did participants have type 2 diabetes?
  • Was the result treatment-policy or trial-product estimand?
  • Were discontinuations included?
  • How many participants reached the planned exposure?
  • Was weight regain after stopping assessed?
  • Were cardiovascular events measured?
  • Were gallbladder and pancreatic events reported?
  • Was body composition measured?
  • Is a CagriSema result being attributed to cagrilintide alone?
  • Is a regulatory submission being presented as approval?
  • Is an MHRA paediatric plan being presented as authorisation?
  • Is the source selling the product it describes?

Medical and Editorial Review

This final article has been reviewed for medical context, evidence presentation, patient safety language and editorial clarity by the multidisciplinary panel below.

The reviewers and contributors are identified to provide clear authorship and accountability. Their inclusion does not represent endorsement of any research product, supplier, personal use, treatment claim or commercial statement discussed in this article.

Dr Laura Geige
Medical Director and Clinical Reviewer

Dr Laura Geige

Medical Director and Senior Aesthetics Practitioner at It’s Me & You Clinic, with a background in dentistry, medical aesthetics and cosmetic dermatology.

Dr Rimas Geiga
Medical and Nutritional Sciences Reviewer

Dr Rimas Geiga

Medical doctor with a special interest in nutritional sciences, dietology, metabolic health and evidence based preventative care.

Dr Snieguole Geige
Medical and Healthcare Reviewer

Dr Snieguole Geige

Dentist and medical doctor with experience across healthcare, preventative medicine and patient centred clinical standards.

Dr Giedre Narkiene
Dermatology Reviewer

Dr Giedre Narkiene

Medical doctor and board certified dermatologist with expertise in medical and cosmetic dermatology, skin health and patient safety.

Dr Veronika Matutyte
Medical and Gerontology Reviewer

Dr Veronika Matutyte

Medical doctor with training and professional experience in gerontology and healthcare management across clinical and hospital settings.

Livija Samušienė
Cosmetology and Skin Health Contributor

Livija Samušienė

Qualified cosmetologist with a Bachelor of Health Sciences in cosmetology and a professional interest in skin health, acne and evidence based aesthetic care.

Cagrilintide Peptide UK Frequently Asked Questions

Evidence-led answers about amylin biology, clinical trials, safety, analytical quality and regulation.

What is cagrilintide?

Cagrilintide is an investigational, lipidated 37-amino-acid analogue of human amylin.

Is cagrilintide a peptide?

Yes. It is a chemically modified peptide with an attached fatty-acid side chain and may also be described as a lipopeptide.

How many amino acids does cagrilintide contain?

Its main peptide chain contains 37 amino-acid residues.

What is the cagrilintide sequence?

The backbone sequence is KCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP-NH₂, with a Cys2-to-Cys7 disulphide bond and lipidated Lys1.

Is the amino-acid sequence alone complete cagrilintide?

No. Authentic identity also requires the correct gamma-glutamyl-linked fatty side chain, disulphide bond and C-terminal amidation.

What is amylin?

Amylin is a pancreatic hormone released with insulin that contributes to satiation, gastric movement and post-meal metabolic signalling.

Is cagrilintide natural human amylin?

No. It is based on human amylin but contains six substitutions and a large lipid side chain.

Is cagrilintide a GLP-1 receptor agonist?

No. It activates amylin and calcitonin-family receptors rather than the GLP-1 receptor.

What receptors does cagrilintide activate?

It activates the recognised amylin-receptor subtypes and the calcitonin receptor.

Why is cagrilintide long acting?

Its fatty side chain promotes albumin association, which slows clearance and enzymatic breakdown.

What is the reported cagrilintide half-life?

An early human trial reported a half-life ranging from approximately 159 to 195 hours.

What is CagriSema?

CagriSema is an investigational fixed-dose combination of cagrilintide and semaglutide.

Is cagrilintide the same as semaglutide?

No. They have different amino-acid structures and activate different receptor systems.

What did the phase-two cagrilintide trial show?

It reported dose-related weight reduction reaching approximately 10.8% at the upper studied exposure after 26 weeks, compared with approximately 3.0% for placebo.

What did cagrilintide monotherapy achieve in REDEFINE 1?

The trial-product estimand showed an estimated 11.8% mean weight reduction at 68 weeks, compared with 2.3% for placebo.

Did cagrilintide alone produce 22.7% weight loss?

No. The 22.7% estimate concerned CagriSema among participants assumed to remain on treatment.

What was the main REDEFINE 1 CagriSema result?

Mean weight reduction was 20.4% under the treatment-policy estimand and 22.7% under the trial-product estimand.

Why are there two REDEFINE 1 percentages?

The treatment-policy analysis includes the effect of discontinuation and treatment changes, while the trial-product analysis estimates what would occur if participants adhered to treatment.

What did REDEFINE 2 show?

In adults with overweight or obesity and type 2 diabetes, CagriSema produced 13.7% mean weight reduction under the treatment-policy estimand, compared with 3.4% for placebo.

Does cagrilintide treat type 2 diabetes?

CagriSema is being studied for type 2 diabetes. No authorised independent cagrilintide diabetes indication was identified.

What are the common cagrilintide adverse effects?

Clinical trials commonly report nausea, constipation, diarrhoea, vomiting and injection-site reactions.

Are adverse effects more common with CagriSema?

Gastrointestinal events were more frequent with the combination than with cagrilintide monotherapy in REDEFINE 1.

Can cagrilintide affect the gallbladder?

Gallbladder-related disorders occurred in the clinical programme. Rapid weight reduction itself can also increase gallstone risk.

Has pancreatitis occurred in trials?

Small numbers of pancreatitis events were reported in CagriSema trials. The available numbers are insufficient to define comparative risk precisely.

Can cagrilintide cause low blood sugar?

Risk depends on diabetes status, food intake and accompanying medicines, particularly insulin or insulin-releasing treatment.

Does cagrilintide preserve muscle?

It is not an established muscle-preserving medicine. Substantial weight loss generally includes some lean soft-tissue reduction.

Is cagrilintide approved by the FDA?

No FDA approval for cagrilintide was identified as of 22 July 2026.

Is CagriSema FDA approved?

Novo Nordisk submitted CagriSema for FDA review in December 2025, but no approval was identified on the review date.

Is cagrilintide approved in the UK?

No current UK marketing authorisation was identified.

Does an MHRA paediatric investigation plan mean approval?

No. A paediatric plan governs medicine-development obligations and does not constitute marketing authorisation.

Does “Research Use Only” settle the UK legal status?

No. The MHRA may assess intended use, pharmacological action, claims, imagery, instructions and the complete commercial presentation.

Is cagrilintide prohibited in competitive sport?

It was not identified by name on the reviewed 2026 WADA list. As an unapproved pharmacologically active substance, it may fall under section S0, so athletes require a current official ruling.

Does 99% HPLC prove cagrilintide is authentic?

No. It does not prove full sequence, lipid attachment, disulphide pairing, C-terminal amidation, potency, endotoxin control or sterility.

What should a cagrilintide certificate include?

It should include intact mass, full sequence, substitution confirmation, lipid-linker identity, attachment site, disulphide mapping, amidation, assay, impurities, aggregates and batch-specific quality results.

Does this article provide cagrilintide dosing instructions?

No. It does not provide preparation, reconstitution, injection, titration, dose selection, treatment-cycle, combination or self-experimentation guidance.

Key Takeaways

  • Cagrilintide is an investigational long-acting amylin analogue.
  • Its main peptide chain contains 37 amino-acid residues.
  • It contains six substitutions relative to human amylin.
  • The molecule has a Cys2-to-Cys7 disulphide bond.
  • Its C-terminal proline is amidated.
  • A fatty side chain is attached to Lys1 through a gamma-glutamyl linker.
  • The lipid modification promotes albumin association and prolonged exposure.
  • Human research reported a half-life of approximately 159 to 195 hours.
  • Cagrilintide activates amylin receptors and the calcitonin receptor.
  • It is not a GLP-1 receptor agonist.
  • CagriSema combines cagrilintide with semaglutide.
  • Phase-two cagrilintide monotherapy produced dose-related weight reduction.
  • Cagrilintide monotherapy produced 11.8% estimated reduction in REDEFINE 1 under the trial-product estimand.
  • The 22.7% REDEFINE 1 result concerned CagriSema rather than cagrilintide alone.
  • The treatment-policy CagriSema result was 20.4%.
  • CagriSema also produced substantial weight and glucose changes in type 2 diabetes.
  • Gastrointestinal effects are common.
  • Gallbladder and pancreatitis events require continued monitoring.
  • Substantial weight reduction can include loss of lean soft tissue.
  • Long-term cardiovascular-outcome evidence remains in development.
  • Cagrilintide monotherapy is being studied in the phase-three RENEW programme.
  • CagriSema was submitted to the FDA in December 2025.
  • No UK marketing authorisation was identified.
  • Research-market vials are not validated by clinical-development results.
  • A conventional HPLC purity percentage cannot establish authentic cagrilintide identity.

Relevant It’s Me & You Clinic Peptides UK Resources

Explore related evidence-led articles and contributor profiles.

Retatrutide Peptide UK

Compare cagrilintide with an investigational GLP-1, GIP and glucagon triple-receptor agonist.

Browse related peptide guides

References

  1. World Health Organization. Recommended International Nonproprietary Names, List 85: cagrilintide. WHO Drug Information. 2021;35(1). WHO structural definition
  2. Fletcher MM, Keov P, Truong TT, et al. AM833 is a novel agonist of calcitonin-family G-protein-coupled receptors. ACS Pharmacology & Translational Science. 2021. PubMed record
  3. Lau DCW, Erichsen L, Francisco AM, et al. Once-weekly cagrilintide for weight management in people with overweight and obesity: a multicentre, randomised, double-blind, placebo-controlled and active-controlled, dose-finding phase-two trial. The Lancet. 2021;398:2160–2172. PubMed record
  4. Enebo LB, Berthelsen KK, Kankam M, et al. Safety, tolerability, pharmacokinetics and pharmacodynamics of concomitant administration of multiple doses of cagrilintide with semaglutide 2.4 mg for weight management. The Lancet. 2021;397:1736–1748. PubMed record
  5. Frias JP, Deenadayalan S, Erichsen L, et al. Efficacy and safety of co-administered once-weekly cagrilintide with semaglutide in type 2 diabetes. The Lancet. 2023;402:720–730. PubMed record
  6. Garvey WT, Böttcher M, Brown P, et al. Coadministered cagrilintide and semaglutide in adults with overweight or obesity: REDEFINE 1. New England Journal of Medicine. 2025;393:635–647. PubMed record
  7. Garvey WT, et al. REDEFINE 1 full trial report. New England Journal of Medicine
  8. Davies MJ, et al. Cagrilintide–semaglutide in adults with overweight or obesity and type 2 diabetes: REDEFINE 2. New England Journal of Medicine. 2025. PubMed record
  9. Novo Nordisk. REDEFINE 1 cagrilintide and CagriSema trial results, R&D Investor Event. June 2025. Investor research presentation
  10. Novo Nordisk. CagriSema demonstrated superior HbA1c reduction and weight loss in REIMAGINE 2. 2 February 2026. Company announcement
  11. Novo Nordisk. Annual Report 2025: innovation, CagriSema submission and cagrilintide RENEW development. Official annual-report information
  12. ClinicalTrials.gov. REDEFINE 1, NCT05567796. Trial registry
  13. ClinicalTrials.gov. REDEFINE 2, NCT05394519. Trial registry
  14. ClinicalTrials.gov. REDEFINE 3 cardiovascular-outcomes study, NCT05669755. Trial registry
  15. ClinicalTrials.gov. Cagrilintide monotherapy RENEW study, NCT07220642. Trial registry
  16. ClinicalTrials.gov. Cagrilintide monotherapy in overweight or obesity and type 2 diabetes, NCT07220759. Trial registry
  17. Medicines and Healthcare products Regulatory Agency. Cagrilintide paediatric investigation plan, MHRA-102266-PIP01-25. MHRA development record
  18. Medicines and Healthcare products Regulatory Agency. Semaglutide and cagrilintide obesity paediatric investigation plan. MHRA combination-development record
  19. Medicines and Healthcare products Regulatory Agency. Cagrilintide and semaglutide type 2 diabetes paediatric investigation plan. MHRA diabetes-development record
  20. European Medicines Agency. Cagrilintide and semaglutide paediatric investigation plan. EMA development record
  21. Carvas AO, et al. Cagrilintide lowers body weight through brain amylin-receptor pathways. 2025. PubMed record
  22. D’Ascanio AM, Mullally JA, Frishman WH. Cagrilintide: a long-acting amylin analogue for the treatment of obesity. Cardiology in Review. 2024;32(1):83–90. PubMed record
  23. Medicines and Healthcare products Regulatory Agency. Borderline products: how to tell if your product is a medicine. Updated July 2026. MHRA borderline-product guidance
  24. Medicines and Healthcare products Regulatory Agency. Guidance Note 8: A guide to what is a medicinal product. Revised May 2026. MHRA Guidance Note 8
  25. Human Medicines Regulations 2012, Regulation 279. UK medicinal-product advertising restriction
  26. World Anti-Doping Agency. The 2026 Prohibited List. WADA 2026 Prohibited List
  27. International Council for Harmonisation. ICH Q2(R2): Validation of Analytical Procedures. ICH analytical guideline
  28. UK Accreditation Service. Laboratory accreditation and ISO/IEC 17025. UKAS laboratory guidance

Educational, Medical and Research Disclaimer

This article is provided solely for general scientific, analytical, metabolic, medical and regulatory education. It does not constitute personalised weight-management advice, diabetes treatment, nutritional advice, prescribing advice, pharmaceutical validation, anti-doping advice or legal advice.

It does not describe or endorse obtaining, importing, preparing, reconstituting, injecting, titrating, dosing, cycling, combining or personally experimenting with cagrilintide, CagriSema, semaglutide or another metabolic peptide.

Clinical findings concern defined investigational medicines used within controlled research programmes. They should not be interpreted as proof that a research-market vial is authentic, sterile, clinically equivalent, safe or effective.

Average trial weight reductions do not predict individual outcomes. CagriSema results should not be attributed to cagrilintide alone, and trial-product estimands should not be presented without explaining their treatment-adherence assumptions.

Products marked “Research Use Only” are not automatically authorised, legally compliant, correctly sequenced, correctly lipidated, accurately quantified, endotoxin controlled, sterile, pharmaceutically equivalent or suitable for human use.

It’s Me & You Clinic does not supply, prescribe, recommend or administer research-market cagrilintide or CagriSema. Anyone concerned about obesity, diabetes, unexplained weight change, persistent vomiting, severe abdominal pain, dehydration or medication-related adverse effects should seek assessment from an appropriately qualified healthcare professional.


Previous     Next
Patient Experiences

Real Patient Transformations at It’s Me and You Clinic

Discover why clients across South West London and Surrey choose It’s Me and You Clinic for their facial aesthetics journey. Located in Siddeley House on Kingston Hall Road, our doctor-led clinic is celebrated for delivering stunning, natural-looking results that enhance your unique beauty rather than altering it. From popular anti-wrinkle injections to advanced dermal fillers, our premium treatments are highly recommended by patients and beauty influencers alike for our precise techniques and exceptional safety standards. Whether you are commuting via Kingston Train Station or parking at the nearby Bentalls Shopping Centre for a day of self-care, our welcoming team is dedicated to providing a transformative experience tailored completely to you.

Diren’s Microneedling Experience

Diren from pilateswithdiren recently visited our doctor led facility for a rejuvenating microneedling treatment and highly recommends her calm, professional experience. Located at Siddeley House near Kingston Train Station and the Bentalls Shopping Centre, our clinic specialises in bespoke skin health for clients across South West London and Surrey.

Mila’s Aesthetics Journey with It’s Me and You Clinic

We love the beautiful, natural looking results beauty blogger Mila from thedopaminediaries achieved at our Kingston upon Thames clinic. Based in Siddeley House near Kingston Train Station and the Bentalls Shopping Centre, our doctor led team delivers premium, tailored facial treatments for clients across South West London and Surrey.

Jessie’s Skin Booster Treatment

Jessie from jessie_foodies_london visited our clinic to experience the advanced Neauvia Hydro Deluxe skin booster treatment for a deep hydration lift. Our doctor led team at Siddeley House near Kingston Train Station and the Bentalls Shopping Centre specialises in these premium micro injections to boost collagen across South West London and Surrey. Jessie loved her quick session, gentle care, and the plumper, glowing results with minimal downtime.

Erika’s Cheek Filler Transformation

Erika from lolsbox1 visited Dr Laura Geige for a bespoke cheek filler treatment to address long standing structural insecurities and restore her facial confidence. Our doctor led team at Siddeley House near Kingston Train Station and the Bentalls Shopping Centre specialises in these advanced contouring procedures for clients across South West London and Surrey. She was absolutely thrilled with her glowing results, noting that the highly recommended treatment left her smiling and feeling incredibly confident.

JOIN OUR PRIVATE SKIN COMMUNITY

Gain exclusive early access to Dr Laura’s busy clinic days, premium anti ageing tips, and bespoke skin transformation insights.

Loose skin treatment at It’s Me and You Clinic in London, Kingston upon Thames and Surrey – skin tightening for face, neck, stomach and arms using HIFU, radiofrequency and non-surgical lifting to treat sagging and ageing skin.

Wait ! Before you go....

⭐ WIN FREE AESTHETIC TREATMENTS ⭐

Have you visited It's Me & You Skin Clinic?

Share your experience and you'll be entered into our exclusive prize draw for the chance to win complimentary aesthetic treatments, premium skincare products, and clinic vouchers.

✨ Thank you for supporting our doctor led skin clinic in Kingston Upon Thames. Your feedback helps future patients and allows us to continue providing exceptional care across Surrey and London.

Prize draw terms and conditions apply.